SecReT6
Protein ID: 514409112
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08850
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1872422..1873933 [+]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDR9ZBG8
KEGG IDprp:M062_08850
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.90E-70, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 2.00E-22, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 454..493
AAA_5 [PF07728], Evalue: 1.70E-07, Aligned region: 219..337
GAF_3 [PF13492], Evalue: 0.00016, Aligned region: 29..149
GAF_3 [PF13492], Evalue: 0.00016, Aligned region: 202..261
HTH_30 [PF13556], Evalue: 0.00027, Aligned region: 463..495
GAF_2 [PF13185], Evalue: 0.0012, Aligned region: 37..174
GAF_2 [PF13185], Evalue: 0.0012, Aligned region: 286..290
Protein Sequence: 503 a.a.     [Download]
>gi|514409112|ref|YP_008132214.1| Fis family transcriptional regulator [Pseudomonas aeruginosa RP73]
MFSRVPQPLAFAEALLAQFGALSRETDITALLGGFARAVGELSGCELSQLYLLDQTHTALTLNAECRDGL
LQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAAEQPWLSLLCVPLVSPEKTVEGMV
VCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGEPQGPSSAPVVSGYGLIGRSAAMRETCRLIS
KVLHNPYTVLLQGETGTGKEVVARAIHEYGPRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRP
GLFDAADGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFRE
DLYYRLAQFPIELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGEMLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAARELGLPRRTLIYR
MGRLNIHFGDPRT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1872422-1873933 Pseudomonas aeruginosa RP73, complete genome
ATGTTCAGCCGCGTACCGCAACCCCTGGCCTTCGCCGAAGCCCTGCTCGCTCAGTTCGGCGCGCTGTCGC
GGGAAACCGACATCACGGCCCTGCTGGGCGGTTTCGCACGCGCAGTCGGCGAACTCAGCGGCTGCGAGCT
GAGCCAGTTGTATCTGCTCGACCAGACCCATACCGCGCTCACCCTCAACGCCGAATGCCGGGACGGCCTG
TTGCAGGCGCTGGAGCCGTCGAGCCTGCCGGCGGACTACACCGGCGAGCAGTTGCTGCAGTTCGCCCTGT
GCCAGAACCGCGTGGTCAGTCTCGTCGACCTGCCGTCGCGGCTGCACGAGACCGGCTTCCTGCCGGCAGC
GGAGCAGCCCTGGCTGTCCCTGCTCTGCGTTCCGCTGGTGAGCCCGGAGAAAACGGTCGAGGGCATGGTG
GTCTGCGCTACCCGGCGCCCACTGGACCTGCAGGGATTCGCCCATCCACTGGGCCAGCTGGGCTCGTTCG
TGCTGGCCCAGCTGCATCTGCTGCAACGCCTCTCGCAACCTTCCGGCGAGCCGCAGGGACCGTCCAGCGC
ACCGGTGGTCAGCGGCTACGGGCTGATCGGCAGGAGCGCGGCGATGCGTGAGACCTGCCGCCTGATCAGC
AAGGTCCTGCACAACCCCTATACCGTGTTGCTGCAGGGCGAGACCGGCACCGGCAAGGAGGTGGTCGCAC
GGGCGATCCACGAGTACGGCCCGCGGCGTGCACAGGCGTTCGTGGTGCAGAACTGCGCGGCGTTTCCGGA
AAACCTGCTGGAAAGCGAGCTGTTCGGCTACCGCAAGGGCGCCTTTACCGGTGCCGAGCGCGATCGTCCC
GGGTTGTTCGATGCCGCGGATGGCGGAACCCTGCTGCTCGACGAAATCGGCGACATGCCCCTCTCGCTCC
AGGCCAAGCTGTTGCGCGTGTTGCAGGAAGGCGAGATTCGCCCGCTCGGCGGCAACGACACGCACAAGGT
CGATGTACGCATCATCGCCGCTACCCACCGTGACCTCGCCCTGCTGGTACGCGATGGCAAGTTCCGCGAA
GACCTCTACTACCGGCTGGCGCAGTTTCCCATCGAGTTGCCGCCGTTGCGCCAGCGCGAGGGCGACGCCC
TCGAACTGGCCCGGCATTTCGCCGAGCGCGCCTGCGTGTTCCTGCGCCGCGCGCCGCTGGGCTGGTCCGC
GGAAGCGCTGGAACTGCTCGACGGCTATGGCTTTCCCGGCAACGTTCGGGAGCTGAAGGGACTGGTGGAA
TGCGCGGTACTGCTCTGCGAAGGCGAGATGCTGCTGGCCGAACACTTTTCCCTGCGCGCGCCCCCGGAAG
CGGAGGCGCCGCTCAAGCTGCGCGAGCATCTGGAGCAGATCGAACGGGACCTGCTGCTCGCCTGCCTGCG
CAGGAACGCTGGCAACCAGACCCTCGCCGCGCGCGAACTGGGTCTGCCGCGACGAACCCTGATCTATCGC
ATGGGACGCCTGAACATTCATTTCGGCGATCCCCGGACCTGA
 Primer design