SecReT6
Protein ID: 514409119
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08885
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1881628..1882356 [+]
Productprotein phosphatase
NoteStp1
UniProt IDR9ZER8
KEGG IDprp:M062_08885
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|514409119|ref|YP_008132221.1| protein phosphatase [Pseudomonas aeruginosa RP73]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1881628-1882356 Pseudomonas aeruginosa RP73, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCGCGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGGTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
GGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGTCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGTGCCCTGAGCGGCGCCGCACGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design