SecReT6
Protein ID: 514409120
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08890
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1882353..1883342 [+]
Productserine/threonine protein kinase
NoteStk1
UniProt IDR9ZCM8
KEGG IDprp:M062_08890
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.20E-40, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 4.60E-25, Aligned region: 53..306
APH [PF01636], Evalue: 4.70E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.70E-05, Aligned region: 171..203
APH [PF01636], Evalue: 4.70E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0028, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|514409120|ref|YP_008132222.1| serine/threonine protein kinase [Pseudomonas aeruginosa RP73]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1882353-1883342 Pseudomonas aeruginosa RP73, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGGACGGTCTACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAGTCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCATGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGTTCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAAGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design