SecReT6
Protein ID: 514409683
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12300
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2648788..2649873 [-]
ProductFis family transcriptional regulator
NoteSfa3
UniProt IDR9ZFK7
KEGG IDprp:M062_12300
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 9.70E-69, Aligned region: 22..188
Sigma54_activat [PF00158], Evalue: 9.70E-69, Aligned region: 300..308
Sigma54_activ_2 [PF14532], Evalue: 3.60E-21, Aligned region: 26..192
AAA_5 [PF07728], Evalue: 5.40E-09, Aligned region: 46..162
AAA_5 [PF07728], Evalue: 5.40E-09, Aligned region: 262..302
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 42..65
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 100..163
AAA [PF00004], Evalue: 0.00046, Aligned region: 46..162
HTH_30 [PF13556], Evalue: 0.0014, Aligned region: 315..347
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 243..259
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 308..343
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 35..83
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 280..298
AAA_2 [PF07724], Evalue: 0.0091, Aligned region: 42..141
Protein Sequence: 361 a.a.     [Download]
>gi|514409683|ref|YP_008132893.1| Fis family transcriptional regulator [Pseudomonas aeruginosa RP73]
MSVITHPHARELTKSVRATVLVFNDPRSRELLERIERLAPSEANALVIGETGTGKELVARHIHALSGRSG
GPFVAVNCGAFAESLVESELFGHEKGAFTGALQSKAGWFEAANGGTLFLDEIGDLPPSIQVKLLRVLQER
EVVRLGSRRPIPIDVRLVAATNVDLADAVVAGHFREDLFYRLHVATIQLPPLRERRGDILPLAEYFIVEH
CRRLGYTSASLSPEAERKLLGHSWAGNIRELENAIHHALLVCRNRLIQPADLHLIDMRARQEPSGLRRAP
ESAAGSALEAALQALFEENREDLYEHIEETVFRAAYRFCHGNQLQTGRLLGISRNIVRARLEKIGELETS
PRHNVVSLVGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c2649873-2648788 Pseudomonas aeruginosa RP73, complete genome
ATGTCCGTCATCACCCATCCCCACGCCCGCGAGCTGACCAAATCGGTGCGCGCCACCGTGCTGGTGTTCA
ACGACCCCCGTTCCCGCGAGCTGCTGGAGCGCATCGAGCGCCTGGCGCCCAGCGAGGCCAACGCGCTGGT
CATCGGCGAGACCGGCACCGGCAAGGAGCTGGTGGCGCGCCATATCCATGCCCTCAGCGGACGCAGCGGC
GGCCCGTTCGTCGCGGTCAACTGCGGTGCATTCGCCGAGAGCCTGGTGGAGAGCGAGCTGTTCGGCCACG
AGAAGGGCGCCTTTACCGGTGCGTTGCAGAGCAAGGCCGGCTGGTTCGAGGCGGCCAACGGCGGCACCTT
GTTCCTCGACGAGATCGGCGACCTGCCGCCGAGCATCCAGGTCAAGCTGCTGCGCGTGCTGCAGGAGCGC
GAGGTGGTGCGGCTCGGTTCGCGCCGGCCGATCCCCATCGACGTGCGGCTGGTGGCGGCGACCAACGTTG
ACCTGGCCGACGCGGTGGTCGCCGGGCACTTCCGCGAGGACCTGTTCTACCGCCTGCACGTGGCGACCAT
CCAACTGCCGCCGTTGCGCGAGCGCCGCGGCGATATCCTGCCGCTGGCCGAGTACTTCATCGTCGAGCAC
TGCCGGCGCCTCGGCTACACCAGCGCGAGCCTGAGCCCGGAAGCCGAGCGCAAGCTGCTCGGGCATTCCT
GGGCGGGCAATATCCGCGAGCTGGAGAACGCCATCCACCACGCGCTGCTGGTCTGCCGCAACCGCCTGAT
CCAGCCGGCCGACCTGCACCTCATCGACATGCGTGCACGCCAGGAGCCGAGCGGCTTGCGCCGCGCCCCC
GAGAGCGCCGCCGGCTCGGCGCTGGAAGCGGCGCTGCAGGCACTGTTCGAGGAAAACCGCGAGGATCTCT
ACGAGCACATCGAGGAAACCGTGTTCCGCGCCGCCTATCGCTTCTGCCACGGCAACCAGTTGCAGACCGG
ACGCCTGCTGGGGATCAGCCGCAACATCGTGCGCGCCCGCCTGGAGAAGATCGGCGAGCTGGAAACCTCG
CCACGACACAACGTGGTCTCGCTGGTGGGCAAGTGA
 Primer design