SecReT6
Protein ID: 514409684
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12305
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2649983..2651083 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDR9ZGG8
KEGG IDprp:M062_12305
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 213..229
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 248..262
Protein Sequence: 366 a.a.     [Download]
>gi|514409684|ref|YP_008132894.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLQRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLPEEQPPVAEADAAEG
DVDGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c2651083-2649983 Pseudomonas aeruginosa RP73, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAAGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTCGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTGCAACGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCGCTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGCCCGAAGAACAGCCACCGGTCGCGGAGGCGGACGCCGCCGAAGGC
GACGTGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGACCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTATCGGCAACTGCTGCTGATCGCCGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAATGGGGCAACAAGCCGCTGAGCGAGCTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGGGTCTGGTCGCTGCTTGGCGTGCTGCCCTAG
 Primer design