SecReT6
Protein ID: 514409687
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12330
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2657744..2658289 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDR9ZD11
KEGG IDprp:M062_12330
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-52, Aligned region: 9..161
Protein Sequence: 181 a.a.     [Download]
>gi|514409687|ref|YP_008132899.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNE
ILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDD
LDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2657744-2658289 Pseudomonas aeruginosa RP73, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCG
AGATCGGCAACGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGATACCCCGCCGGCGAAGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAG
ATCCTCTCCTCCATCTCTCCCCGCGCCACCCTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGC
TGAACGTCGAGCTGCGCTTCAACCACATCGAGGACTTCGACCCGGTCAACCTGGTGAAGCAGGTGGTCCC
GTTGCGTCGCCTGTTCGAAGCGCGCCAGCGCCTGCGCGACCTGCTGACCAAGCTCGACGGCAACGACGAC
CTCGACCAGTTGCTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCGGCCCGCCCGG
AAGCCGAAGCGGCCCCGGCCGGCGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA
 Primer design