SecReT6
Protein ID: 514409688
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12335
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2658312..2659796 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDR9ZFL0
KEGG IDprp:M062_12335
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.50E-190, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|514409688|ref|YP_008132900.1| EvpB family type VI secretion protein [Pseudomonas aeruginosa RP73]
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDKDTVAMINDRI
SQIDALISDQLNQIIHHPELQKLEATWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLTKIFESLELIKWRAFRESEDSRYVSLVLPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAA
WVLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISL
CHKKNSDVAVFFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2658312-2659796 Pseudomonas aeruginosa RP73, complete genome
ATGCCCAAGTCATCCGCCGCCGAACAATCCGGCGAGAGTTCGACCCAGACCCTGTCCCTGCTCGACGAGA
TCATCGCCAAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTATGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTCCTCGACGAGGGCATGGCCGTCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGATGCGCTGATCAGCGACCAGCTCAACCAGATCATCCACCACCCCGAGTTGCAGAAGCTGG
AAGCCACCTGGCGCGGCCTGCACCAACTGGTGAGCAACACCGAGACCAGCGCGCGGCTCAAGCTGCGCCT
GCTGAACGTCGGCAAGAACGAACTGCAGAACGACCTGGAGAAGGCGGTCGAGTTCGACCAGAGCGCACTG
TTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGACACCCCTTCAGCCTGCTGATCGGCGACT
TCACCTTCGGTCGCCATCCGCAGGACATCGGCCTGCTGGAGAAGCTGTCGAACGTCGCCGCGGCTGCCCA
CGCGCCGTTCATCGCCGCCGCCAGCCCACGCCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTGCCA
CGCGACCTGACCAAGATCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCGCCTTCCGCGAAAGCGAGGACT
CGCGCTACGTGTCGCTGGTGCTGCCGAACTTCCTCTTGCGCCTGCCCTACGGCCCGGAGACGCGACCGGT
GGAAGGCATGAACTATGTCGAGGACGTCAACGGCACCGACCACTCCAAGTACCTCTGGGGCAACGCCGCC
TGGGTCCTGGCGCAGCGCATCACCGAGGCCTTCGCCAAGTACGGCTGGTGCGCGGCGATCCGCGGCGCGG
AAGGCGGCGGCGCGGTCGAGGGCCTGCCGGCGCACACGTTCCGCACCAGCTCCGGCGACCTGTCGCTGAA
GTGCCCGACCGAGGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGATCTCGGCTTCATTTCCCTG
TGCCACAAGAAGAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAGGCTCTACA
ACACCAACGAGGCCAACGCCAACGCGCGCCTGTCGGCGATGCTGCCGTACGTGCTGGCGGCATCGCGCTT
CGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTGAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCACCGCAGGAAATCAAGGCGCAGT
ACCCGCTGCGCGAGGCGCGGGTGGATGTCAGCGAGGTGGCCGGCAAACCGGGGGCCTACCGCGCCACGGT
GTTCCTCCGGCCGCACTTCCAGCTCGAGGAACTCAGCGCGTCGATCCGCCTGGTCGCCAACCTGCCGCCG
CCGGTAGCGGCGTGA
 Primer design