SecReT6
Protein ID: 514409689
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12340
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2659870..2660367 [+]
Producthypothetical protein
NoteTssD
UniProt IDR9ZGH2
KEGG IDprp:M062_12340
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|514409689|ref|YP_008132901.1| hypothetical protein M062_12340 [Pseudomonas aeruginosa RP73]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2659870-2660367 Pseudomonas aeruginosa RP73, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTC
AACGAGTATTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCAACCTGGGACCTGGCCGCCAACCAGCTGG
TCAAGTGA
 Primer design