SecReT6
Protein ID: 514409690
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12345
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2660380..2660805 [+]
Producttype VI secretion protein
NoteTssE
UniProt IDR9ZE60
KEGG IDprp:M062_12345
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|514409690|ref|YP_008132902.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVCHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2660380-2660805 Pseudomonas aeruginosa RP73, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTTGAGGTGTGCCATGAGCGATTC
GATTGA
 Primer design