SecReT6
Protein ID: 514409692
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12355
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2662546..2663562 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDR9ZD16
KEGG IDprp:M062_12355
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|514409692|ref|YP_008132904.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPAASRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGAPPRLSWNTGLRRVEDSQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2662546-2663562 Pseudomonas aeruginosa RP73, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGCTGCCGCTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGCCTCGGCGGCCCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAGCGTGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGCTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGCGCCCTCAGCGGCCTGTTGCCGAAAGCCC
TGCAAGAGCGCCTGGCGCTGCCGGACAGCGCGGTACTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCATTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCGCGGCCAGCCGCAGCCGGCTGCAACGCGGCGGACGCAACCTGCGCCTGG
GTCGCGACGCCATAGCCGGCACGCGCACCTGGGACGAGCACGCCGGCATCGCCCTCAGTCTCGGTCCGCT
GGATGCCCGCGAAGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTACTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTGCACCGCCCAGGCTGAGCTGGAACACCGGCCTGCGGCGCGTCGAAGACAGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA
 Primer design