SecReT6
Protein ID: 514409694
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12375
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2667941..2669944 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDR9ZGH7
KEGG IDprp:M062_12375
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-68, Aligned region: 44..321
Phage_base_V [PF04717], Evalue: 1.70E-22, Aligned region: 350..443
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 500..522
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 535..556
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 559..582
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 640..653
Protein Sequence: 667 a.a.     [Download]
>gi|514409694|ref|YP_008132908.1| type IV secretion protein Rhs [Pseudomonas aeruginosa RP73]
MSRGTDTSSLSLVAELLSDLNLETLTGGERLNTLDSMSLQGNSSTSLTLSNTVASHLSATLHNDSQQRPL
DALVAEIHQLPADATADRFQLVLRPWLWWLTLASNNRVFQNLATSDIVTTIFKAHGFTDFKLSLTGSYEP
REYCVQYGETDFAFVSRLLEEEGIFWFFIHEVGKHTLVLADSNDAFPPIPNGPKVPYLDQEIGVRELHGI
RSAQYCLQAVAGTYSATDYEFTTPSTSLYSQAQAEAGPRARYEHPGGYTAKGRGDALTKQRVDGLRSQEK
RLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRMH
TQTALVVGKAGEEIWTDQYGRIKLQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTFI
DGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVNV
LNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGGN
YSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKAG
TSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2004 bp     [Download]
>gi|514407635|ref|NC_021577.1|:2667941-2669944 Pseudomonas aeruginosa RP73, complete genome
ATGTCTCGCGGCACTGATACCAGCAGCCTCTCATTAGTCGCCGAGTTGTTGAGCGACCTAAATCTGGAAA
CCCTAACCGGAGGCGAGAGGCTGAATACATTGGACAGCATGTCTCTCCAGGGCAACAGCTCCACGTCGCT
GACACTATCCAACACCGTCGCCTCGCACCTCAGCGCCACCCTGCACAACGACTCCCAGCAACGCCCCCTC
GACGCCCTGGTCGCCGAAATCCACCAGCTCCCCGCCGACGCAACTGCCGACCGTTTTCAACTCGTACTCA
GACCATGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGCGTGTTCCAGAACCTCGCCACCAGCGACAT
CGTCACCACGATCTTCAAGGCCCACGGCTTCACCGACTTCAAGCTGTCGCTGACCGGCAGCTACGAGCCC
CGTGAATACTGCGTGCAGTACGGCGAGACCGACTTCGCCTTCGTCTCGCGCCTGCTGGAGGAGGAAGGCA
TCTTCTGGTTCTTCATCCACGAAGTGGGCAAGCACACGTTGGTGCTGGCGGACAGCAACGACGCCTTCCC
GCCGATCCCCAACGGGCCCAAGGTGCCATACCTGGACCAGGAGATCGGCGTGCGCGAACTGCACGGCATC
CGTTCGGCGCAGTACTGCCTGCAGGCGGTCGCCGGGACCTACAGCGCCACCGACTACGAGTTCACCACAC
CCAGTACTTCGCTCTATTCCCAGGCACAGGCCGAGGCCGGGCCGCGCGCACGGTACGAACACCCCGGCGG
CTACACCGCCAAGGGCCGCGGCGATGCGCTGACCAAGCAGCGCGTGGACGGCCTGCGCAGCCAGGAAAAG
CGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATGACG
ACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCGCAA
CCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATGCAC
ACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCAAGC
TCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCGTCGTGCTGGGTGCGCGTGGTGCTGCC
CTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTCATC
GACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACGCGC
TGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGAGCT
GCGCTTCGAGGACAAGAAGGACGCCGAGGAGGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAACGTG
CTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCACGCACCCGCACGG
TGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAGCGA
CAGCCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGCAAC
TACAGCCACAAGGTCAGCGGCAACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCGGCA
CCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCTGGCAC
CTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCCGGC
ACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACGGCG
GCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTCAACTGA
 Primer design