SecReT6
Protein ID: 514413045
SecReT6 ID814
T6SS typei4a
Gene symbol-
Locus tagM062_12320
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2655668..2656960 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDR9ZN85
KEGG IDprp:M062_12320
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-69, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|514413045|ref|YP_008132897.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRMQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPAFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVSGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c2656960-2655668 Pseudomonas aeruginosa RP73, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGAGTGACCGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCA
AGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCGCCGCTGGAGTTCGACCTGGAGACAGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGCGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ACGTCAGCCTGCCCTACGTCCCGCCGACGCCACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCATGCA
GTCGCTCTGCGCGCGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGCAACCAGGACGACGCGGTGGAAATCCGTCGCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCG
AAGGCCTGCTGGCAAGCCGTGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGTTGGAGCGCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTATTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGT
CGGCCTGCGGATGCCCGCCGGCGCCGGCGAACAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGACCCGCACCTGCCGTTGCTCGCCCGGCAACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTTGGCGACGACACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAG
 Primer design