SecReT6
Protein ID: 51595007
SecReT6 ID62
T6SS typei3
Gene symbol-
Locus tagYPTB0656
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]779321..782815 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ66EN6
KEGG IDyps:YPTB0656
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.00E-75, Aligned region: 498..796
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 905..1024
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 95..114
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 194..375
Protein Sequence: 1164 a.a.     [Download]
>gi|51595007|ref|YP_069198.1| hypothetical protein YPTB0656 [Yersinia pseudotuberculosis IP 32953]
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPL
PKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYE
SSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYP
GVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDEL
LAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGL
FEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYE
QLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLK
VYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRI
KAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQ
LQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAA
LLARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQP
EPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGA
MQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSI
LEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLG
VNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|51594359|ref|NC_006155.1|:779321-782815 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGATACGCAGAATGTTGATTTTAATCATTGCCCTAGTGCTTTGTTATATTGTGTGGTGGATAGGGCCGC
TGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGGTATGGGTTCGTAAGATCATTATTGCTCTGATTTT
ATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGCCCGTGCGCCACTT
CCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGATGCGATGCTCACCC
TGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGCGTAAGCGCCAGTA
TATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTCGATAGTTTATGAG
AGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATTGGACCGACGCAGG
ACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGATCCTGCTGCATGG
TCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATATCGCCGTTATCCG
GGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTGACGGAACGTAAGT
CACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCGATATTGCGGTGTA
CTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGCTAATGAACGACGAACTT
CTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGTCAGAACAATTTCGTTGCCGATGAAG
AACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATATTGCACGATTCGCCCAATAT
GGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACCCCTGTTTGGCTTA
TTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTCTGGTTTGGCAGTA
CCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCTTTGAAAGCCGGCCTGC
TGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACACGCCACCGGCCCA
ATGCCTCTGCGAAATCGCCTGTTAAACATCGGTAAGTATGTGTTCGTGGTCCTTGTGCTCTGCATCTTAT
TGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAGCTCGGTTTGAGGA
AACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGTCGCAGCTTACGAA
CAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACACCGTACTTCGAGCACC
GTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCTGGCCTGCGGTACA
AAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTATGACACGCTGAAA
GTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGGTTTATGTCGCGCT
GGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATCATTTGAGTGAACT
GTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCGTGAATCACGCATT
AAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCACTGCCCGCGAGGA
TTGAGGATCTTAGTCTGGCTGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGACGTAAAAGCCCCAG
TACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGTGGTTAACCCACAA
CTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGTAAAGCTTCGGTTA
GTCAGGTTAGTTTACTGGCTGCTGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATTATCTGATGGAGTA
TGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACTTGATGATGCGGCG
CTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTCTCCACACGTGAAA
TAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCAATATTCAACGTAATAA
GCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTTTCGTCTAACGCCA
GAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTGCAAAGTGCGTCTACCA
GCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACACTCTCGACTTCCCT
TCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATATGGCCCGTCAGCCA
GAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTGCAACAAAGTAAGG
CCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCAGTGGCCGTTATCC
CTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGGTCGTTCTGGGGCG
ATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGCTGGAAGGTAAAAC
CTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCACAAATCCGCGACAC
CTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACTGACTCCATCAATT
TTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAACCAACCGGTAAAAG
TTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGGATGGAAATGTGGA
AACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCCTAGGCCACTCGGG
GTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATTGAGTTGAGTTCCA
CCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGAATCTCTAA
 Primer design