SecReT6
Protein ID: 51595820
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1483
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1775792..1776292 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ66CC3
KEGG IDyps:YPTB1483, yps:YPTB3252
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|51595820|ref|YP_070011.1| hypothetical protein YPTB1483 [Yersinia pseudotuberculosis IP 32953]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1775792-1776292 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGTGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAACAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCTCCC
TGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGCCAA
AAGAGGGTTAA
 Primer design