SecReT6
Protein ID: 51595821
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1484
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1776335..1777885 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ66CC2
KEGG IDyps:YPTB1484
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-177, Aligned region: 15..53
DUF877 [PF05943], Evalue: 3.70E-177, Aligned region: 92..512
Protein Sequence: 516 a.a.     [Download]
>gi|51595821|ref|YP_070012.1| hypothetical protein YPTB1484 [Yersinia pseudotuberculosis IP 32953]
MLMSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSV
FLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIE
LLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAA
HMPFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVK
IPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKL
YAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1776335-1777885 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGG
CACAAGGGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGA
GGCGTTCCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTC
TTTTTAGACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATA
TTGCCGCACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGT
GGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAG
CTGCTGGATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTT
TATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAA
CTACGAGTTCGACCGCAGCCCGCAAGATATCGCCTTATTGCGCAATATCTCCAAAGTGGCGGCTGCAGCC
CATATGCCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAGGTGGCGGCCA
TCAAAGATATCGGCAACTACTTTGACCGCGCTGAATACATCAAATGGAAAGCTTTCCGCGACTCGGATGA
TTCCCGCTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCGTACGGGCCAGACACGGTGCCA
GTGCGCAGCTTCAACTACGTTGAGCAGGTGAAAGGGCCAGACCACGATCGCTATTTGTGGACCAATGCCT
CGTTTGCCTTTGCCGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGCGTACAGATCCGTGGGCC
ACAAGCCGGTGGTGCAGTCACCAACCTGCCAATCCACCTGTATGACTTGGGTACCGGTAATCAAGTTAAA
ATCCCGTCAGAAGTGATGATCCCGGAAACGCGCGAATTTGAGTTTGCCAACCTGGGTTTTATCCCGCTGT
CGTACTACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCAGCCCAGAAACCGGCGCTGTATGA
CACCGCGGATGCCACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATT
GCCCATTATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGG
AGCTGAACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCA
TCCCCTGCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTG
TATGCGGTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGG
CTAAGGCATAA
 Primer design