SecReT6
Protein ID: 51595823
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1486
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1779246..1779932 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ66CC0
KEGG IDyps:YPTB1486
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|51595823|ref|YP_070014.1| hypothetical protein YPTB1486 [Yersinia pseudotuberculosis IP 32953]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1779246-1779932 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTACAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAAACTGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTAATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCCGGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA
 Primer design