SecReT6
Protein ID: 51595824
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1487
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1779932..1781668 [+]
ProductOmpA family outer membrane protein
NoteTagL
UniProt IDQ66CB9, Q66CB9
KEGG IDyps:YPTB1487
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.50E-15, Aligned region: 447..543
Protein Sequence: 578 a.a.     [Download]
>gi|51595824|ref|YP_070015.1| OmpA family outer membrane protein [Yersinia pseudotuberculosis IP 32953]
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSDPLFAGLATEN
GLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVN
PQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGS
LADWQRAESRAVQAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLW
QHWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAW
QNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDA
QANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQVPD
VKTASQDESDVSTQEMEK
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1779932-1781668 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAGTCGGTGGTGGCAACGTGGGTTGTGGCTCTGGGCGGGTTTGCTGGCGGTCATCTTGTGTCTGGCAT
TTCTGCCGCTCTCCCCGTGGGGGCGCTGGCTGATGCTGGCATGGGTGGTGCTGATTTGCATGTTGGGCGG
GTCGCGGGCAGGGCGGCAAGCGGCCGGTGCATCCTCTGATCCGCTGTTCGCCGGGTTGGCAACTGAAAAC
GGTCTTCTGCCTGAAAACAGTCGCTTACCGGTGGTGTTGGTATGTGGTGATGGTCTGGCGTCATGGTTTG
GTCGCGAACGGTCACACCAGAGTGCACAGGGCTGCTGGCTGCGGGTGGATGATATCAGCACCCTGCGGCA
GTTTGCCCGACAACTGCTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTCGTGAAC
CCGCAGCAACGCCGCGATGAGCGCCTGCTGGCCGCCGATCTGCAAGAGCTGCGCTGGCAACTGATGCAAC
TGCGCCGCGATAGCCGCCATCCAGTTCCCTTGCTCCTGAGCAGCACGGTGGCCACCTCGGTTGCCCGTGA
TACGGTCTGGCTGTCACAGCAGCAGACACCGCCGCTGACACTCTGGTCAACCGTCTCGACGCCGGGCTCT
CTGGCCGACTGGCAGCGTGCGGAAAGCCGTGCCGTACAGGCTGAACGACTGAAACAGGCGGTGCTGTTCA
GCAGCCAGCATGACTGGCTGAACGCACAGGTGCTGCCGGTATTGCAGGCACCCAATGCGGATGTTGCCCC
CCTTGCCCCGCAACAGATTATTCAACAGCAGGTTGCCAGTCTGGCCGATCCGGTGCCTGCCTCGCTGTGG
CAGCACTGGCTGGCGGCGCATACCACGCTGACACAGGTGGCGGGTTGGCATCCACCGCCGCCCGCCGCCC
ATGACGCCTTACCGCTGCCGGATTTTGTCTTTTCAGCGCTTCCTCTTGGTAGCGGGGTGTCGTCACGCCG
TCGGGTACTGCGCCATGGTGTCACCTTACTGACGTTGGCGGCGATGGTGGCGTTGTGCAGCAGCGCCTGG
CAGAACCGGCAACTGTTGCACCGGGTGGCCTTTGATATCCGTCAGTACCACAGCGTGGCGATGACGGATT
ATTCCCCGAAAGCGCAGGCGGTGGCGGTATTACGCCGTGATGCGGGGCTGCTTGATGAAGGGTACCGCAA
CGGTGAACCGCTGCGTCTGGGCCTGGGGTTATATCGGGGGGAGCGGCTGCGCCCGCCGCTGTTGGCGGCG
ATCAAAAGCTACATCCCGCCCCCTCCGCCCCCTCCCGCGCCACCGGCGCCGAAAACCGTGCGCCTCGACA
GCCTGTCACTGTTCGATGTGGGTAAATTCACGCTGAATGCGGGGTCCACCAAAATGCTGGTCACGGCGCT
GATCGACATCAAAGCCAAACCCGGCTGGCTGATCGTGGTGGCCGGGCATACCGACATCACCGGCGATGCG
CAGGCCAACCACATTCTGTCGCTTAAGCGCGCCGAAGCATTACGCGACTGGATGCTGTCAACCAGCGACG
TCTCGCCGACCTGCTTTGCGGTGCAAGGTTACGGGGCCACACGCCCTATCGCCGACAACGATACTCCCGA
CGGTCGGGCGCTCAACCGCCGGGTCGAAATCAGTCTGGTACCACAGGCTGATGCCTGTCAGGTGCCGGAT
GTAAAAACAGCGTCACAGGATGAAAGTGACGTATCAACGCAAGAAATGGAGAAGTAA
 Primer design