SecReT6
Protein ID: 51595826
SecReT6 ID63
T6SS typei2
Gene symbolclpB3
Locus tagYPTB1489
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1782551..1785199 [+]
ProductClp ATPase
NoteTssH
UniProt IDQ66CB7
KEGG IDyps:YPTB1489
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 611..775
AAA [PF00004], Evalue: 8.90E-20, Aligned region: 239..351
AAA [PF00004], Evalue: 8.90E-20, Aligned region: 616..734
AAA_5 [PF07728], Evalue: 9.70E-15, Aligned region: 239..261
AAA_5 [PF07728], Evalue: 9.70E-15, Aligned region: 336..369
AAA_5 [PF07728], Evalue: 9.70E-15, Aligned region: 615..736
ClpB_D2-small [PF10431], Evalue: 1.80E-13, Aligned region: 782..860
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 142..156
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 216..261
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 456..532
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 588..659
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 4.30E-12, Aligned region: 753..807
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 61..111
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 614..652
AAA_25 [PF13481], Evalue: 1.40E-08, Aligned region: 239..306
AAA_25 [PF13481], Evalue: 1.40E-08, Aligned region: 293..327
AAA_25 [PF13481], Evalue: 1.40E-08, Aligned region: 613..644
Arch_ATPase [PF01637], Evalue: 3.30E-07, Aligned region: 217..255
Arch_ATPase [PF01637], Evalue: 3.30E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 3.30E-07, Aligned region: 608..654
Arch_ATPase [PF01637], Evalue: 3.30E-07, Aligned region: 685..702
NACHT [PF05729], Evalue: 6.90E-07, Aligned region: 239..336
NACHT [PF05729], Evalue: 6.90E-07, Aligned region: 615..636
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 233..300
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 615..635
AAA_19 [PF13245], Evalue: 9.70E-06, Aligned region: 236..261
AAA_19 [PF13245], Evalue: 9.70E-06, Aligned region: 613..637
Zeta_toxin [PF06414], Evalue: 1.00E-05, Aligned region: 233..263
Zeta_toxin [PF06414], Evalue: 1.00E-05, Aligned region: 449..512
Zeta_toxin [PF06414], Evalue: 1.00E-05, Aligned region: 614..655
AAA_14 [PF13173], Evalue: 1.80E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.80E-05, Aligned region: 614..705
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 614..651
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 798..816
Sigma54_activat [PF00158], Evalue: 6.10E-05, Aligned region: 221..253
Sigma54_activat [PF00158], Evalue: 6.10E-05, Aligned region: 615..732
Clp_N [PF02861], Evalue: 0.00091, Aligned region: 23..59
Clp_N [PF02861], Evalue: 0.00091, Aligned region: 112..125
Clp_N [PF02861], Evalue: 0.00091, Aligned region: 453..472
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 616..637
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 238..256
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 575..636
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 239..261
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 616..645
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 239..257
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 614..637
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 224..257
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 615..629
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 792..834
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 239..261
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 614..660
Protein Sequence: 882 a.a.     [Download]
>gi|51595826|ref|YP_070017.1| Clp ATPase [Yersinia pseudotuberculosis IP 32953]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LAHLDTLPRTVQGKPQLSAALQQLIKNAWLDASLQEDADAVRSVHLLSALINSPSLLAADAAWPLLSLST
TQLHRLLPLLDSQSDERPEVQQAAALADSPVNLTNEAATTTSASGQPQLNDALQAALDKFTLDVTAKAKT
GQIDPIFGRDSEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPTPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMEINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQQTLEQQYKEEKRLTTLIIEARQDIANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPAL
LARFQTLIYRPLNAPALRTIVEMKLAQVANRLKKHYGLHCTLEASLYDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWDEADGITLEFEGGEK
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1782551-1785199 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGTCGGTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCCG
CCACCCTGTGTCAGACCCGCGCCCATGCTGAGATCACTGTCGAACACTGGTTGTTAAAATTGCTGGAGCA
GGGCGAAGGCGATATTACAGTCATTGCCCGGCGTTATGAGTGGGACATGGACAGCCTGTGGCAGGGATTA
CTGGCCCATCTGGACACCTTGCCGCGCACGGTACAGGGCAAACCTCAGTTGTCCGCCGCGTTACAGCAAC
TGATCAAAAACGCCTGGCTAGATGCCTCGTTGCAGGAAGATGCCGATGCGGTGCGTTCCGTTCATCTGTT
ATCTGCTCTGATAAATTCGCCATCATTACTGGCCGCCGATGCCGCCTGGCCGTTGCTCAGCCTGAGTACC
ACCCAGTTACACCGCCTGTTACCGCTACTGGACAGCCAATCAGACGAACGCCCTGAAGTTCAGCAGGCAG
CGGCACTGGCAGACAGCCCGGTCAATCTGACCAATGAGGCAGCGACTACTACCTCTGCCAGCGGCCAGCC
GCAACTCAATGACGCCCTGCAAGCGGCGCTGGATAAATTTACGTTGGACGTCACCGCCAAAGCGAAAACC
GGGCAGATTGACCCGATTTTTGGTCGCGACAGCGAGATCCGCCAGATGGTCGATATCCTGTCGCGCCGCC
GTAAAAATAACCCGATTCTGGTCGGTGAACCGGGTGTGGGTAAAACCGCCTTGGTTGAAGGGCTGGCACT
GCGTATTGCCGAGGGCAACGTACCGGACAGCTTAAAAACCGTCAGTGTGCGCACTCTGGACTTGGGCCTG
TTGCAAGCCGGGGCTGGGGTCAAAGGTGAGTTCGAACAGCGGCTGAAAAATGTTATCGAGGCGGTACAAC
AATCACCGACGCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATCATCGGTGCCGGTAATCAGGCCGG
TGGCGCAGATGCGGCCAACCTGCTGAAACCGGCACTGGCGCGTGGCGAGTTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTTCTGACCGGTCGC
CAACTGCCGGACAAAGCGGTGGATCTTCTCGACACCGCAGGTGCGCGCGTGCGCATGAGCATCGACACCT
TGCCGACTGCGTTGATGGAGATTAACGCCGAACTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCAAACACTCGAACAGCAATATAAAGAAGAGAAGCGGTTGACCACCCTGATTATTGAGG
CGCGTCAGGACATCGCCAACGCAGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATTCAGGGCAA
TGCGCCGCTGTTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGTGTG
CCGCTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTGGAAAATCGTCTGGGCGAGCGAG
TAATTGGGCAGGATGCGGCATTAGGCGCGCTGGCGCAACGGCTGCGGGCGGCGAAAACCGGCCTGACATC
AGAGAATGGTCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGCTG
GCACTGGCCGACAGCCTGTTCGGCGGGGAAAAATCGCTGATTACCATCAACTTATCGGAGTATCAGGAAG
CACACACCGTCTCCCAATTGAAAGGGTCGCCCCCGGGCTATGTCGGTTACGGACAGGGCGGCGTATTGAC
CGAAGCGGTGCGCAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTCGAGAAGGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGCGGTTTTATGCGCGACGGTGAAGGGCGCGAAATTGATTTCC
GCAACACGGTGATAGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTGGATGAGCAACC
GGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCAATATTGCGCGACCACTTCCAGCCCGCGCTG
CTGGCCCGCTTCCAGACGCTGATCTACCGCCCACTGAATGCCCCCGCGCTGCGCACCATCGTCGAAATGA
AACTGGCACAGGTCGCTAACCGCCTCAAAAAACATTACGGCCTGCACTGCACTCTTGAAGCAAGCCTGTA
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAG
CAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGGATGAAGCCGACGGCATTACCCTTGAATTTGAAGGAGGCGAAAAATGA
 Primer design