SecReT6
Protein ID: 51595827
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1490
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1785196..1787694 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ66CB6
KEGG IDyps:YPTB1490
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 6.50E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 3.30E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 3.30E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 2.70E-15, Aligned region: 393..481
Protein Sequence: 832 a.a.     [Download]
>gi|51595827|ref|YP_070018.1| hypothetical protein YPTB1490 [Yersinia pseudotuberculosis IP 32953]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGAITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKAKQVVAMPEFQL
IPGGKHNLQFLFTDDDNVPYSNTPYIAYLVDGREIKGVTDAKGNTEKFVTDEEQNIKINLQV
 
Nucleotide Sequence: 2499 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1785196-1787694 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACTATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGATTTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGTGATTACAACTACCGCACCGCCACTGCCGA
TATGACCGCCGGGGCCGACATCACGCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCCGGGTTACGAAAGCTTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATCGCGTTTGAAGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTTGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGAGCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATAACGC
TAAATGCAGGCGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAAGCGAAGCAGGTAGTGGCAATGCCAGAATTTCAGCTG
ATTCCCGGTGGGAAGCATAATCTACAATTTCTATTTACCGATGATGATAATGTACCTTATTCAAATACAC
CGTATATTGCTTATCTTGTCGATGGAAGAGAAATTAAAGGAGTGACAGATGCAAAAGGTAATACGGAAAA
ATTTGTTACCGATGAAGAGCAAAATATAAAAATAAATTTACAGGTATAG
 Primer design

Protein ID: 51595830
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1493
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1789798..1792500 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ66CB3
KEGG IDyps:YPTB1493
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-64, Aligned region: 34..354
DUF2345 [PF10106], Evalue: 5.70E-49, Aligned region: 610..757
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 589..618
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 4.10E-15, Aligned region: 390..481
Protein Sequence: 900 a.a.     [Download]
>gi|51595830|ref|YP_070021.1| hypothetical protein YPTB1493 [Yersinia pseudotuberculosis IP 32953]
MNTSLPAIRFDHSHHKLVVRDSTAPVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLADVGLWFRFTADPKLNIDVVEFYDDQRFYPP
GLTLQAVPPSGMHDSGVESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLIAGSEEREPESESGAFYARLRHERYLNNQARFSGVANAATLGPSQELKVTGNDVPAQFGKGVIIIRI
TSYARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGLFISAD
GQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASPADLQAQISLLQQNLSELKQAVVLLSAPKGI
ALSSGEHLQMSASENLIATAGKNTDISVAKNLFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTENEIKITAKKRITLNAGGSYITLDENRIESGTAGEYITKAGHYERQEKASLKSIIPAFPI
IEPGEHSLRFAFYGDDNVIGSMGHLVGQPYNIRNSAGEVIASGVLDQSGRFPRVKTQEADELTLTLGEEK
WTVEELIASTEDPIGEEFSEPDEYDVDSDPYFENIAQEQQSNRLPDTIINKFIGYVEEDI
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1789798-1792500 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATACCTCTCTCCCCGCTATTCGGTTTGACCATAGCCATCACAAACTGGTGGTCCGCGACAGCACGG
CTCCCGTCGATGTGCTGGGTTTTGAAGGCCACGAAAGCTTAAGTCAGCCGTTCTGTTACGACATTCAATT
TACCAGCGCAGACAAGGCGATTGACCCGGCCACGATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCCTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGCGTGGTGACCGGAT
TTAAACGCCTGTCTGCTTCAAAAGATGAATGCCGTTACGAACTGAGCCTGCAACCGCGTTTGGCTTTGTT
GTCGCGTAGCCATCAGAACGGGATTTATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCCCGCCGTGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCAGCCGCCTGCTGGCGGATGTGGGGCTCTGGTTTCG
TTTTACCGCTGACCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAACGTTTTTACCCGCCA
GGGCTGACGCTACAAGCGGTGCCACCTTCGGGGATGCACGACAGCGGCGTGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCTGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGATCGCAGGCAGCGAAGAGCGTGAGCCGGAAAGTGAAAGTGGGGCGTTTTATGCCCGCCTGC
GCCATGAACGTTACCTGAACAATCAGGCGCGCTTTTCGGGGGTAGCCAATGCGGCGACACTGGGGCCGAG
TCAGGAACTGAAAGTCACCGGAAACGATGTGCCGGCACAGTTTGGTAAAGGGGTGATAATCATCCGCATC
ACCAGCTATGCCCGCCGTGACCGCAGCTATGAAGTGCATTTTGAGGCTATCCCTTACTCCGAAGATTATT
GCTTCCGTCCAGCACTTATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACCTATGGTCATATCGACAAAGACGGGCGTTACCGTGTCAATCTGATGTTCGACCGTGAC
AGTTGGGAGCCGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCACTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAGGATGGCAACCCGGACCGGCCCTA
TATTGCTTATGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGCAACGTA
CTTCGCACTCCGTCGAATAACAAACTGCGCCTTGAAGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCACGGGGTGA
AGGTTTTGAGCTGCGTACCGACAGTTTTGGTGCATTGCGTGCAGAAAAGGGCCTCTTTATCAGTGCCGAC
GGTCAGGCCAAAGCCCAGGGGCAGGTGCTGGAGATGCAACCGGCTATTAGCCTGTTGCAAGGTGCTCAGG
AACAGATGGATGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTGCAGCAAAATCTGAGTGAGCTGAAACAAGCCGTGGTATTGCTGAGTGCGCCAAAAGGCATT
GCCTTGAGCAGTGGTGAGCATCTGCAAATGTCCGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATA
CCGACATCAGCGTAGCAAAGAACTTATTTATTGGTGTGGGAAATACCTTAAGTATCTTCGTCAGAAAACT
GGGGATGAAGCTGATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTGATGGAGTTATTG
GCGCGCAAGGCGATAACGATCACCAGTACCGAGAATGAGATAAAAATCACCGCCAAGAAGAGGATTACGC
TGAATGCGGGCGGCAGTTATATCACGCTGGATGAGAATCGGATTGAGTCAGGCACGGCTGGTGAATATAT
AACCAAAGCAGGGCATTACGAGCGGCAGGAAAAGGCGAGTTTAAAATCTATAATACCTGCTTTTCCTATT
ATTGAACCGGGAGAACATAGTTTACGGTTTGCATTCTATGGTGACGATAATGTTATTGGGTCTATGGGAC
ATCTTGTCGGGCAGCCTTACAATATCCGTAATAGCGCTGGTGAAGTTATAGCTTCAGGAGTATTGGATCA
ATCTGGCCGTTTCCCAAGAGTAAAAACTCAAGAAGCGGATGAGTTAACGCTGACTTTAGGTGAGGAAAAA
TGGACAGTAGAAGAGCTTATAGCGTCAACAGAAGATCCTATCGGTGAGGAGTTTAGCGAACCTGATGAAT
ACGATGTAGATAGTGATCCTTATTTCGAAAATATCGCTCAAGAACAACAAAGTAATAGATTGCCTGATAC
AATAATTAATAAATTTATTGGCTATGTAGAAGAGGATATCTAG
 Primer design