SecReT6
Protein ID: 51595837
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1500
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1802287..1803345 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ66CA6
KEGG IDyps:YPTB1500
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.10E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 3.50E-10, Aligned region: 10..65
Protein Sequence: 352 a.a.     [Download]
>gi|51595837|ref|YP_070028.1| hypothetical protein YPTB1500 [Yersinia pseudotuberculosis IP 32953]
MAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVNGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTLSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1802287-1803345 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCTGCGGCGGCGTGATCATCGAAGGTGACG
CCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGACAGAGTGACCTGCGGTAAACATCCGGG
AACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAATGGCCGCAAGTTTGCTGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCTATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACCCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA
 Primer design