SecReT6
Protein ID: 51595841
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1504
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1806724..1807425 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ66CA2
KEGG IDyps:YPTB1504
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.70E-39, Aligned region: 71..226
Protein Sequence: 233 a.a.     [Download]
>gi|51595841|ref|YP_070032.1| hypothetical protein YPTB1504 [Yersinia pseudotuberculosis IP 32953]
MTRRCQTIYLNILPWRWATTVGWLHSNIKKETDVLTTVWKNKTCTSKNKTCTSKHKSWAAWKNKICIPAL
VLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFL
KTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDD
LHPDKPRTLELGNNSLTLRAEKK
 
Nucleotide Sequence: 702 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1806724-1807425 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGACGCGACGCTGTCAGACGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGC
TCCACAGCAACATCAAGAAGGAAACCGACGTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAA
AAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATAAAATCTGCATCCCCGCACTG
GTTTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCACCGTGTCGGCCACAAAATCAC
TGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAAGCCCTGAATACCGATGCGCA
CGAGGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTACGTGATGATAAAACCTTCCTC
AAAACGGTGTATCAACAACTGGCAAGTGACGGGGAGGCGGCGCTTAAAGATGACCTGCTGGCCAGCCGTA
GTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAAAAAGAGACCCAGTTTGTGGC
AGTGGTGGCGCTGTTCCGCCATCCGGATATGGCCAAAGACCACTGGCGTCTGATACTCACGCTGGACGAC
CTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGCAATAACAGCCTGACATTGCGGGCGGAGAAAAAAT
AA
 Primer design