SecReT6
Protein ID: 51595843
SecReT6 ID63
T6SS typei2
Gene symbol-
Locus tagYPTB1506
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]1807902..1809269 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ66CA0
KEGG IDyps:YPTB1506
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.30E-50, Aligned region: 115..150
DUF3702 [PF12486], Evalue: 3.30E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 1.40E-18, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 1.40E-18, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|51595843|ref|YP_070034.1| hypothetical protein YPTB1506 [Yersinia pseudotuberculosis IP 32953]
MAGNTERLLKIGGDPRALADFTALRGELNKLAHPARPDVDWARVEQLCLALFRQNGVELQTTVDFTLART
HIAGIVGLCEGLELLAGLVCHQWSGLWPPQMHARVALLAWLSDRLQQEWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPTSLSANSIA
ELKKQASDVEWARLAEPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRA
AGAAPLVELKHYALAQERLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|51594359|ref|NC_006155.1|:1807902-1809269 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAATCGGTGGCGACCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGACTGGGCGCGGGTTGAGCAACT
GTGTCTGGCGCTGTTTCGCCAGAACGGCGTTGAGTTGCAGACCACGGTAGATTTTACCCTGGCGCGTACT
CACATTGCTGGAATAGTGGGGTTATGTGAAGGACTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGA
GTGGGTTATGGCCACCGCAAATGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAGCGACCGGCTGCAGCA
AGAGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTGCTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGACATCACTGAGCGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
TGCAGTTAGATCAACTAACACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCGACCAATCAAGAGGTCAAACGACTGAATGCGTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGAACGGCTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGTTATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATTCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAACTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA
 Primer design