SecReT6
Protein ID: 51596975
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2656
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3133795..3134601 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ668T1
KEGG IDyps:YPTB2656
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.30E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|51596975|ref|YP_071166.1| hypothetical protein YPTB2656 [Yersinia pseudotuberculosis IP 32953]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
ATTGCFAWIADSDGRMGPVCEFISAGGYRWVPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCV
 
Nucleotide Sequence: 807 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3134601-3133795 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAGCCAACGGATACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTGCTGGCAGGCAAACGCAGCCCTG
GTACGTTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGC
GCTACGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGTATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGGTCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAGATAGATTGTGTTTGA
 Primer design