SecReT6
Protein ID: 51596977
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2658
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3135469..3135729 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ668S9
KEGG IDyps:YPTB2658
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 6..78
PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 73..86
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 16..36
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 38..70
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 75..85
Protein Sequence: 86 a.a.     [Download]
>gi|51596977|ref|YP_071168.1| hypothetical protein YPTB2658 [Yersinia pseudotuberculosis IP 32953]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTG
CGSVIVTGSPNVFIGN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3135729-3135469 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATG
TGTTCATTAACAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGC
GCTGGTAACTGGCTCTGGAACGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGG
TGTGGCTCGGTTATTGTCACTGGGTCGCCCAATGTATTTATAGGTAACTAA
 Primer design