SecReT6
Protein ID: 51596978
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2659
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3135809..3138721 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ668S8
KEGG IDyps:YPTB2659
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-75, Aligned region: 29..347
Phage_GPD [PF05954], Evalue: 1.20E-75, Aligned region: 873..958
Phage_base_V [PF04717], Evalue: 4.50E-24, Aligned region: 387..480
CAF-1_p150 [PF11600], Evalue: 0.0041, Aligned region: 843..957
Protein Sequence: 970 a.a.     [Download]
>gi|51596978|ref|YP_071169.1| hypothetical protein YPTB2659 [Yersinia pseudotuberculosis IP 32953]
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTI
EMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII
EEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRS
FSTAYHAIEYLSDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHW
PGDYDQPDIGEHLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVD
QLSGGEDAFSCESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGM
VSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDV
LGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATL
AAGGPIAIGAGGELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGA
IALPLPLPLLPIVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPE
TTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPRRKQRHRQKQRHRQKQRHRQKQRHRQRQRHRRKQRHRQRQ
RHRQRQRHRRKQRHRRKQRHRRKPRHRQRQRHRQRQRHRRNRREHRQGRRRHRLDFIDKR
 
Nucleotide Sequence: 2913 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3138721-3135809 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTCAAGGACAATAAATTTGAGCAGCCCGGCTATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGT
CTAAGTTGGAAGGCGAGGAAGCTTTTTCGACTTTATATTCTTATACTATTACGGCAAAGACACCGGCTAA
TCCATTAATTCCTTGGCAAGCGGCTTCAAATGTCGATCTCAAATCCTTAATTGGTAAAGAGATGACGATT
GAAATGGAACTGGACGGCAACGGCCTGGGTGATGTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGG
GGCTGGTTGAGAGAGCCAGATACATTGGTCGAGATGCCAATCAGGCCATATTTGAGATCACTATTAAGCC
TTGGTTCTACCTGGCTAATTTAACCTCTGACTTTAAAATTTATCAAAATAAAAATGTCGTTGATATTATA
GAGGAAGTGTTCTCAGACTATAATTTTCCGTTTGAGAAACGGTTGGCTACAACCTATCCGATATTAGATT
TTCAGGTTCAGTACGGTGAAACCGACTTTAATTTCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTG
GTTCTTTGAGCATCAGGATCATAAACAAAAATTAATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCG
TTCAGTACCGCCTACCATGCCATTGAGTACTTGTCAGATGAGCCTAAAGCGGGCGAAGAGTACATCACAC
AATTCCAGACTCAGGAAACCTTGACGAGTGGGACCTGGGTCACCAACGATTATGACTTCACGAAATCCCG
TGCCGATATTCTGGCAATGGACAGTAAACCGCGTAAAACCAGCTTTAACGATCTCGAGATTTATCACTGG
CCAGGGGATTATGATCAGCCAGATATTGGTGAGCACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTC
TGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGCGCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGG
GTTCCCCGTTGATAAAGCGAATCGGGAATACATGATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGAT
CAACTGTCTGGCGGTGAGGATGCGTTTAGTTGCGAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCT
ATCGTCACCCACAGGTGACACCAAAACCGAAAACCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACC
GGGTGAAGAGATTTGGACCGATGAATATGGCCGCGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACA
AACAGCGAGTCAGACTCTTGCTGGCTACGTGTTAGCCAGGCTTGGGCAGGTAACAGCTTTGGTGGGATCT
ATATTCCACGCATTGGTCAGGAAGTCATTGTTGACTGTATTAACGGCGATCCTGACCGGCCAATGGTGAT
GGGCAGCCTTTATAATAACGTGACGCGTCCCCCTTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATG
GTCAGTCGTACTGTTGGCGGCGGGTTAACCAACTATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGG
AGCAGTACTGGGAACAGGCCGAGCGCGATATGTCGCGTTTGACTAAAAATAATGAAACGCAAATTATCGG
TGCCGATTCGGTCCTGAATGTTGGGGCCAACCGAAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTT
CTTGGCACATCAATGTTAGCCATCGGTGCAGCCTCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGG
TTGGCGGAGCACATTCACTGAATGTGGTTTTGGCGAATGCCACCAATGTGGGTGGCGCTAACATGACCAA
TGTAGGGGGATTTAATGGCCTTGCGGTGGGGGGAGCCCATCAGACAGCTGTAGGTGGTGCTGCGACACTG
GCGGCCGGCGGCCCTATTGCTATTGGGGCGGGTGGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTG
TTGGTAAAAGTAAGGTTATTATTCAGGGCGGTGAAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAA
AACGGGCAATGGCGGCGGGGCATTCGGTGCCTTTGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCT
ATTGCCTTACCGCTACCGTTACCCTTGTTGCCAATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAA
CAGTGCCACCGGATCCGACATTGCCACCAGATCCAACGTTGCCACCAGATCCAACGTTACCGCCGGAAAC
AACGGCACCGCCGGAAACCACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAG
ACAACGGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGG
AAACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCC
GGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCG
CCGGAAACCACGGCACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCAC
CGCCAGAGACAACGGCACCGCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAAACAACG
GCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAA
CGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAAC
CACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAACCGACGCGAACACCGCCA
GGGACGCAGACGCCACCGCCTTGATTTTATAGATAAAAGGTAA
 Primer design