SecReT6
Protein ID: 51596980
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2661
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3142851..3144227 [-]
ProductOmpA/MotB family protein
NoteTssL
UniProt IDQ668S6
KEGG IDyps:YPTB2661
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-54, Aligned region: 86..291
OmpA [PF00691], Evalue: 3.40E-16, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|51596980|ref|YP_071171.1| OmpA/MotB family protein [Yersinia pseudotuberculosis IP 32953]
MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPMTYPDSTQDNAAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILG
LGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLI
VATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGD
SMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAG
IPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3144227-3142851 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGGGGCTCAATGCCTCCTTTTGATCAAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAACCAATGACATACCCAGATAGCACTCAGGATAA
TGCGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGG
CTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGT
TGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCTCCGCATGGGTTGATCGCACA
TCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATT
GTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGGAG
CATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGA
TGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGAC
TCCATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGTGATTAAACGCGTCGCGCAGG
AAGTGCATCGCGTTAAAGGGGCAATCCTCATTGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGG
CTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCACGCTATATGGAACAGGCCGGT
ATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGA
CAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA
 Primer design