SecReT6
Protein ID: 51596983
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2664
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3146390..3146959 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ668S3
KEGG IDyps:YPTB2664
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|51596983|ref|YP_071174.1| hypothetical protein YPTB2664 [Yersinia pseudotuberculosis IP 32953]
MCLRIYMGSSYTRCLALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
 
Nucleotide Sequence: 570 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3146959-3146390 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTGCCTCCGTATTTATATGGGGTCTTCCTACACTCGATGTTTGGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGCTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
CGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA
 Primer design