SecReT6
Protein ID: 51596984
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2665
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3147208..3148710 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ668S2
KEGG IDyps:YPTB2665
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-194, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|51596984|ref|YP_071175.1| hypothetical protein YPTB2665 [Yersinia pseudotuberculosis IP 32953]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASI
IAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQ
SPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKDVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3148710-3147208 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATA
CATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAGACGATAGCAGCAGTAGAAGGTGCCGTTAAAAC
GTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGCATTGCTTCCATT
ATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAATTTAATTTTGCACCACCAAGAATTCCAGTCTC
TGGAAAGCGCATGGCGTGGGCTACACTATTTAGTCAATAACACCGAGACTGATGAGAAGTTGAGATTACG
TTTCCTCGACATCTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATAAAGGTGTTGCTTGGGATCAA
AGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAACTGGGTGGCGAACCATACGGTTGCCTGG
TAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
GTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTG
TCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTC
AGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAA
TACCAACCCGGTAGATGCCTTCCATTTTGAAGAGACGACGGATGGCGCGGATCACAGCAAATATGTGTGG
TCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAGAGTATGGCTGGTGTACGCTGA
TTCGTGGGGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACCTTCCCGACGGATGACGGCGG
TATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGCCAAGAATGGT
TTTATTCCACTGGTTCACAGAAAGAATACTGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGC
TTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTCAAAGAGCGTGAT
GAGATGCAACGTTGGTTGAATGACTGGGTGATGAACTATGTTGATGGTGACCCGGCTAACTCTTCTCTGG
AAACTAAAGCGCGCCGTCCTTTAGCCGCTGCTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTA
CTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTGACAGTCTCCCTGCGTATGGTT
GCTAAACTGCCTTCGCTGAAAGACGTAGCATAA
 Primer design