SecReT6
Protein ID: 51596985
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2666
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3148734..3149258 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ668S1
KEGG IDyps:YPTB2666
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|51596985|ref|YP_071176.1| hypothetical protein YPTB2666 [Yersinia pseudotuberculosis IP 32953]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3149258-3148734 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATTGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACG
ATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATC
CGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTC
GATGAGCGTATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCC
AGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTATCGCGAAAAAAGTTGA
TTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTATATGGATGGTAAGGCG
GGTGCTGAGGAATTAGTCATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCATCCGCACCGA
AAGCAAAACAATCCGCTGTTGATACTCCACAGTAA
 Primer design