SecReT6
Protein ID: 51596990
SecReT6 ID64
T6SS typei3
Gene symbolclpB5
Locus tagYPTB2671
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3154431..3157088 [-]
ProductClp ATPase
NoteTssH
UniProt IDQ668R6
KEGG IDyps:YPTB2671
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 619..785
AAA [PF00004], Evalue: 6.10E-21, Aligned region: 233..364
AAA [PF00004], Evalue: 6.10E-21, Aligned region: 624..741
ClpB_D2-small [PF10431], Evalue: 1.10E-16, Aligned region: 791..869
AAA_5 [PF07728], Evalue: 3.90E-13, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 3.90E-13, Aligned region: 623..741
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 271..311
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 442..500
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 498..566
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 621..659
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 688..711
AAA_16 [PF13191], Evalue: 3.10E-08, Aligned region: 787..811
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 623..722
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 366..399
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 621..643
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 685..710
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 233..314
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 622..705
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 287..323
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 621..648
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 621..645
IstB_IS21 [PF01695], Evalue: 3.00E-05, Aligned region: 227..253
IstB_IS21 [PF01695], Evalue: 3.00E-05, Aligned region: 623..643
Zeta_toxin [PF06414], Evalue: 5.20E-05, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 5.20E-05, Aligned region: 616..663
Clp_N [PF02861], Evalue: 6.00E-05, Aligned region: 25..74
Clp_N [PF02861], Evalue: 6.00E-05, Aligned region: 112..122
AAA_29 [PF13555], Evalue: 6.90E-05, Aligned region: 223..253
AAA_29 [PF13555], Evalue: 6.90E-05, Aligned region: 621..648
NACHT [PF05729], Evalue: 8.20E-05, Aligned region: 233..265
NACHT [PF05729], Evalue: 8.20E-05, Aligned region: 623..650
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 286..383
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 622..668
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 63..109
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 234..252
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 378..408
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 623..658
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 233..251
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 625..649
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 233..253
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 469..542
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 621..646
UPF0079 [PF02367], Evalue: 0.0077, Aligned region: 233..253
UPF0079 [PF02367], Evalue: 0.0077, Aligned region: 621..650
Protein Sequence: 885 a.a.     [Download]
>gi|51596990|ref|YP_071181.1| Clp ATPase [Yersinia pseudotuberculosis IP 32953]
MAITRKYLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLWHQEDNDLKQIIRYFAVDVDAFEREL
AQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTRIRSGHLLLALLTTMELRRAFFAIAPSMEKI
PLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASNAIGAAKSGGTLAQYTTDLTALAREGKIDPV
LGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLALAIAAGSMPPALSQVSLLSLDIVALSAGAS
MKGEFETRLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNAGTGDAANLLKPALARGQLRTIGATTWSEFK
RHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKA
ISLLDTACARIAVAQHSQPIELQHLTFQSETAQTELVSLEKARHFGKAQDARTEQLKTSIAEHGEAADKL
DQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQLEAQLSQVRTSLPLVQTEVNAEVIAS
IVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGENIMTARAGLSDPRKPLGVFMLVGPSG
VGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDE
IEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLLADPDTAPDQDGILTALQPE
LLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGARLYSQHQLTLKYSDEVVDDVVSRCAVSETGA
RMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGFVIALQ
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|51594359|ref|NC_006155.1|:c3157088-3154431 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
GTGGCTATTACAAGGAAATATCTCTTCGGCAAGCTGGACGCCACTCTTTTCAAAGGTATTGAAAGCGCAA
CAACGATTTGTAAATTACGCGGCAATCCTTACGTAGAGTTAGTTCACTGGTTGAATCAGCTTTGGCATCA
GGAAGATAACGACCTTAAGCAGATTATTCGGTATTTTGCGGTGGATGTGGATGCCTTTGAGCGTGAGCTG
GCTCAGGCACTTGCGAAGTTACCTGTCGGGGCAACTAGCATTTCAGATTTTTCGTATCATATTGAGTTGG
CCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTTAGATACCCGTATCCGGAGTGGACACCTGCT
GCTGGCGCTATTAACAACAATGGAACTGCGGAGAGCTTTCTTTGCGATTGCGCCAAGCATGGAAAAAATT
CCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACCAGAAGCGAATGAAGCCGCCA
GTGATGGCAGCCCGTTGTACGATGGAGCTTTACCTGGCGAAGCCAGTAATGCCATCGGTGCGGCAAAAAG
TGGTGGCACACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTGAAGGCAAGATAGATCCGGTA
TTGGGACGTAATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCGTCGGCAGAACAACCCATTAC
TGACCGGTGACGCAGGGGTGGGTAAAACCGCCATTGTTGAAGGGCTAGCATTGGCCATTGCTGCAGGCTC
AATGCCGCCAGCATTAAGCCAGGTAAGCCTGTTGTCATTAGATATTGTGGCGCTCTCAGCGGGTGCCAGC
ATGAAAGGTGAATTTGAAACGCGCCTGAAGAGTGTCTTGGATGAAGCAATCGCGGCAGAAAAGCCCGTTA
TTTTGTTTATCGATGAAGTTCACACACTTATTGGCGCGGGTGGCAATGCCGGGACCGGCGATGCGGCGAA
CTTATTGAAACCTGCATTGGCGCGTGGCCAATTACGTACCATTGGTGCGACAACGTGGAGCGAGTTCAAG
CGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCAAGTTGATGAGCCCGATGAGA
ACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCACCATGGCGTGTGGATTATGGA
CGAAGCCTTACAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGCGTCAGTTGCCGGATAAAGCG
ATAAGTCTGCTTGATACGGCTTGTGCCCGGATCGCTGTTGCACAGCATTCACAACCAATAGAGTTGCAGC
ACTTAACCTTCCAGAGTGAGACCGCGCAAACTGAGCTGGTTTCCTTAGAGAAAGCGCGGCACTTTGGTAA
AGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATTGCTGAACATGGCGAGGCTGCAGATAAACTT
GATCAGCGTTGGCAGGCAGAACGCGAGTTGGTATCAGCGATTACGACCATAAGAACCGCACTTTATGACT
TGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCGCAATTAGTCCAGTTGGAAGC
GCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCAACGCTGAAGTGATCGCCAGT
ATCGTTGCAGATTGGACCGGCATCCCGGTTGGGCAAATGCTCAAAGACGATATTCGGGCGGTAATGGAGT
TGCCACAGCGCCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATGCAACTGGGTGAGAATATTAT
GACCGCACGCGCCGGTCTGTCAGACCCAAGGAAACCATTGGGGGTCTTTATGTTAGTGGGGCCTTCAGGT
GTGGGTAAAACAGAGACGGCCTTAGCGATTGCCGAGAGCATGTATGGTGGTGAACAGAATATGATCACTA
TCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTCTTTAAAAGGTTCTCCACCGGGATATGTTGG
ATACGGTGAAGGCGGTGTATTAACGGAAGCCGTGCGCCGTAAGCCATATAGTGTTGTGTTATTAGATGAA
ATCGAAAAAGCGCACTCTGATGTACATGAATTATTCTTCCAAGTGTTTGATAAAGGCCAAATGGAAGATG
GTGAAGGGCGCTTTATCGATTTCAAAAACACTATTTTGCTGTTAACCAGTAATGTGGGCAGCGAGTTACT
GAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATATTAACTGCGTTGCAACCTGAA
TTGCTGAAAGTTTTCCCAGCAGCATTTTTAGGGCGAGTCACGGTTATTCCTTATCTTCCGTTACAGCAAG
ATGCATTGCAGCACATTGTACGGTTACATCTTGACCGGATTGGCGCTCGTTTATACTCGCAGCATCAATT
GACACTGAAATACAGTGATGAAGTGGTTGACGATGTTGTTAGCCGCTGTGCGGTTTCAGAAACCGGTGCA
CGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAAAAATAGGTAAATATATTTTAGGTGATAGTG
ATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTCGTGATCGCTTTACAATGA
 Primer design