SecReT6
Protein ID: 51596991
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2672
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3157872..3159752 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ668R5
KEGG IDyps:YPTB2672
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-202, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|51596991|ref|YP_071182.1| hypothetical protein YPTB2672 [Yersinia pseudotuberculosis IP 32953]
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWP
LEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFEL
LHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ
LSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSR
PLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDE
SAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|51594359|ref|NC_006155.1|:3157872-3159752 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAAATGGCGCAAGAGTTTG
CTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGATCCTTACGTTGA
GCGGCTGATAGAATCCTTCTGTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAA
TTTACTCAGCGTCTTTTGGACATCGTCTATCCCAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCC
AACTTAAGCCAAATCTGAAGGAAGGGGATTTGACTCAAGGGTATTGTGTTCCCAGGGGCAGCTCGTTCTT
CACCCATATCGCACCTGGCGAAACAACCCGCTGCGAGTTCCGTAGTGGTCAGGATGTGGAGTTGTGGCCA
CTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAGCACCGTATTG
CCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGGATCGTTTCACATATCTTCGAGCTG
CTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAAACAGCAAAAGATACCGTGATCA
GTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTT
TCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAG
CTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATCATCATCCTACTGGACAGATTACCGC
AGGATTTGGTGAGCCATGTTGCCCCCTCTCGTTTCCTGTTAGCCTGCACGCCAGTGATTAATCTCTTTCC
TAAACGCATGGATAAGATCGAAATTAACCGTGCATTGAACGATTTTCACGTAGTACCAGACCGCAGCCGC
CCACTGGATTATGAAGTTTTCGCCATTAATAAAGTATTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCG
CAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTC
TTTGTCTCGTTGGTCGATCAACAAGAGGCGCCTTATGGCGATAGCCTGCGCTACCTCTCTATTGAAGCTC
AGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTC
AGCGCCCGTTCACGGTGCCCGGTTTGTGTTCCAACCCAGCGCCCCACGCGCCCCCTTTGCCATGGATGAA
TCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTCAGATATGTCCCACTCGAATG
GGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGAATACACAAAT
TGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACCTTGACCGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTG
GCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTC
CATGCAAAGAGGACGTGTCGGTCACTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA
 Primer design