SecReT6
Protein ID: 51596992
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2673
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3159752..3160777 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ668R4
KEGG IDyps:YPTB2673
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|51596992|ref|YP_071183.1| hypothetical protein YPTB2673 [Yersinia pseudotuberculosis IP 32953]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMKDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|51594359|ref|NC_006155.1|:3159752-3160777 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTTGCCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCATGCGGTTATGAAAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGACTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGACCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTGGCCGGGCTGG
ATCCTCAAGAACTTAATGACACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTATTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAACAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCCGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCAGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA
 Primer design