SecReT6
Protein ID: 51596993
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2674
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3160876..3162069 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ668R3
KEGG IDyps:YPTB2674
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.80E-18, Aligned region: 203..215
Protein Sequence: 397 a.a.     [Download]
>gi|51596993|ref|YP_071184.1| hypothetical protein YPTB2674 [Yersinia pseudotuberculosis IP 32953]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAE
VQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVR
EWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|51594359|ref|NC_006155.1|:3160876-3162069 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAGCCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCTAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGCTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GACATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAGGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTCAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTTTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCGG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCAGAACCTATTGAGACCCC
AGACGTTGTCGAGCTCTATCCGGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAG
GTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTGAGGCTCCCCAACAGCGTCAAGCGGTGGTAA
CCCCATCCCCGCCGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCGCC
GCCGGTGCCTGTCCAACAGCAGGGGATCCAAAACAGGGCTGATGCGTTAGCCCGGCTTATAGAGGTGCGA
GAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCG
GCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGA
GTAA
 Primer design