SecReT6
Protein ID: 51596997
SecReT6 ID64
T6SS typei3
Gene symbol-
Locus tagYPTB2678
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]3165183..3166865 [+]
ProductOMPA family outer membrane porin
NoteTagL
UniProt IDQ668Q9, Q668Q9
KEGG IDyps:YPTB2678
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.20E-18, Aligned region: 190..232
OmpA [PF00691], Evalue: 3.20E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|51596997|ref|YP_071188.1| OMPA family outer membrane porin [Yersinia pseudotuberculosis IP 32953]
MFKVKLNKTLSLLWLAAVGTLLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKPPQVPIPVPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSAQVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSGFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAIKPRVKTPVIKPIPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCVNTFDVTRWGLSQCQTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHSDNTGSSSMNM
TLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|51594359|ref|NC_006155.1|:3165183-3166865 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCACCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACCCCCCCAAGTGCCGATTCCCGTCCCGCAGGAGACA
GCAGAACCGGTAGAACAGGAAAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTCTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCAGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCGGTGATGATGTCAAAACTCACGGTGTGGCAGAACACGTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTATGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAAATTACG
CAAGCCCTACAGTCACTGAGCCAAAGACTTGAGTTACAAGATATCAATCACTCAGGATTTGCAACTCAGC
GTAATGTTATGGCCCATAATTTATTTACCTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCGCGCACCCCCTTACGGCTAACAGACGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAGAAAAAGTTTGGCATCATACCGAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCTGCGGTGATCAATGACCAGAAGCCTGCAATAAAACCACGGGTGAAAACACCGGTGATAAA
ACCTATCCCCGCATCCCGTGGGTGGTTATGGAGTGTGTGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGCGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAACGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACCGATGAAGGTAAAACATTAAC
CACCTGCGTTAATACATTTGATGTGACACGTTGGGGGCTGTCTCAATGTCAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACCAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACAGAATAAAGGGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACGGGCAGTTCCTCCATGAACATG
ACACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA
 Primer design