SecReT6
Protein ID: 521465256
SecReT6 ID815
T6SS typei1
Gene symbol-
Locus tagSCE1572_30330
StrainSorangium cellulosum So0157-2
Repliconchromosome [GenBank: NC_021658] [Browse all T6SS(s) in this replicon]
Location [Strand]8616790..8620506 [-]
Producthypothetical protein
NoteTssM
UniProt IDS4XYV7
KEGG IDscu:SCE1572_30330
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.60E-81, Aligned region: 63..98
ImcF-related_N [PF14331], Evalue: 6.60E-81, Aligned region: 184..450
IcmF-related [PF06761], Evalue: 8.30E-28, Aligned region: 69..77
IcmF-related [PF06761], Evalue: 8.30E-28, Aligned region: 500..832
IcmF-related [PF06761], Evalue: 8.30E-28, Aligned region: 918..989
DUF1215 [PF06744], Evalue: 1.10E-19, Aligned region: 961..1070
Protein Sequence: 1238 a.a.     [Download]
>gi|521465256|ref|YP_008152454.1| hypothetical protein SCE1572_30330 [Sorangium cellulosum So0157-2]
MWLWILTALFLAAVWGVWFMLRPAGGEGAEVLPIEIPIAATAAVLLLLAGLAVYRRIRAARAARALEKAI
AQQAQEQVINAKPERRAEIQELSRQMQEGIAALKASKLGGGRRGADALYVLPWYVMVGPPGAGKTTALRH
SGLVFPYIDPERTGVRGVGGTRNCEWWFTNEAILLDTAGRYTTESDDHDEWMAFLELLLQYREHKPLNGV
IVAVSMSELLDASDDQIDQTGKKIRARIDEMQRTLHMVLPVYVLFTKTDLVAGFTEYFGDLKKSERAQAW
GATVRLDEGKSEPGKIFDREFDVLIERLHSRLTKRLIGERSRDVKERAYQFPLEFAAVKRNLSDFIAAAF
APGAGAAPTPILRGFYFTSGVQEGRPLDRVVGAMGRAFGLRAALGEGEEEAALPKESKSFFLHDVFTNVV
FPDQDLAARSEAELRRRRLQRVLVAAAAALVALLFLLPALISYFNNKALVAETRRISDEIAFVDWSGRSG
APPNVPANIDKLDRLQGHVGKLDQYVENTPLDHGWFMFQGDKLFPPTMGQYIKSLKQGFVGPAKAQLEAK
LERVRDGEFLDGYNALRSYLLLGKGYQDHMDEQAARWQTGRLVQVWADILKPFTDMPESDLKERLTPHVA
YYIDLVRRNKLEAEELNDPLVARARADLLRVDPTKRYYDQFVTSLIDQKYDESGPNTPENLKYPPVSLDE
MFADRPEVLTVIHSAQKNRGGPWFKVEGPYTAKGHAQVLESLKEGRKKLERELWVLPLSNDEKRSGDQIQ
KELDRVRQDYDNAYIAQWEAFFRDIQVDIPKTNRDAIHEFRVLSTPDWPYRRLLQRLHDETQFPVEKPNV
LTADGGIIDRAKDMFAQRVERRTNVQIGSMLPGQGGREHYDPVPDKFESMAGFGVPAAPAEEGQPPPPPP
KLGQYVGHLERLAGEMSVVEDGPPDTDTSRATEAFQDAVKETQTLLLSMDQTGQRLMEPLLMNPLRQAYK
AVVRRAGGAASGIWEVEVWPHYRDKIKDRYPFNLASSRDASLEDAMAFFKPKDGVLWGFYETYLKGFHYQ
VGHEYFPKSHLSGQPQAAKPFTPFNANLYNCLRRSDEITDALFGGGGAEGPKVVFHINMKTVSPIVSEVV
FEVDGQKRLYRNEKEFWHTFNWPGEGAPGARIQVRGAGGLDEELVREGPWGIFRLFEAGTTTAQKDNDAL
FTVTWQMTAPPVTVTMEIRPTRGNHPFPMSFFRATNCPPSIGDRFGKG
 
Nucleotide Sequence: 3717 bp     [Download]
>gi|521458881|ref|NC_021658.1|:c8620506-8616790 Sorangium cellulosum So0157-2, complete genome
ATGTGGCTGTGGATCCTGACCGCCCTGTTCCTCGCCGCCGTGTGGGGAGTATGGTTCATGCTGCGCCCCG
CGGGAGGGGAGGGGGCCGAGGTGCTGCCGATCGAGATCCCGATCGCGGCGACGGCGGCCGTCCTCTTGCT
GCTGGCGGGGCTCGCGGTCTACCGGCGGATCCGCGCGGCGCGCGCCGCGCGGGCGCTCGAGAAGGCGATC
GCGCAGCAGGCGCAGGAGCAGGTGATCAACGCGAAGCCGGAGCGGCGCGCCGAGATCCAGGAGCTGAGCC
GGCAGATGCAGGAGGGCATCGCCGCGCTGAAGGCCTCGAAGCTCGGCGGCGGCAGGCGCGGCGCCGACGC
GCTGTACGTCCTGCCCTGGTACGTGATGGTCGGCCCGCCCGGCGCCGGCAAGACCACCGCGCTCCGCCAC
TCGGGGCTCGTGTTCCCGTACATCGACCCGGAGCGCACCGGCGTGCGCGGCGTCGGCGGCACCCGGAACT
GCGAGTGGTGGTTCACCAACGAGGCGATCCTCCTCGACACCGCCGGCCGGTACACGACCGAGAGCGACGA
CCACGACGAGTGGATGGCGTTCCTCGAGCTCCTGCTCCAGTACCGCGAGCACAAGCCGCTCAACGGCGTC
ATCGTCGCGGTGAGCATGAGCGAGCTGCTCGACGCGAGCGACGACCAGATCGACCAGACCGGCAAGAAGA
TCCGCGCGCGCATCGACGAGATGCAGCGGACGCTGCACATGGTCCTGCCGGTCTACGTGCTCTTCACGAA
GACCGACCTCGTGGCGGGCTTCACCGAGTACTTCGGCGACCTGAAGAAGAGCGAGCGCGCCCAGGCCTGG
GGCGCCACCGTGCGGCTCGACGAGGGCAAGTCCGAGCCCGGCAAGATCTTCGATCGCGAGTTCGACGTGC
TCATCGAGCGGCTCCACTCCCGCCTGACGAAGCGGCTCATCGGCGAGCGGAGCCGCGACGTGAAGGAGAG
GGCCTACCAGTTCCCGCTCGAGTTCGCGGCGGTGAAGCGCAACCTGTCGGACTTCATCGCGGCGGCGTTC
GCGCCCGGGGCCGGCGCGGCCCCCACGCCGATCCTGCGCGGGTTCTACTTCACGAGCGGCGTCCAGGAGG
GGCGGCCGCTCGATCGCGTGGTCGGGGCGATGGGGCGCGCGTTCGGGCTGCGCGCGGCGCTCGGCGAGGG
CGAGGAGGAGGCGGCGCTCCCGAAGGAGTCGAAGAGCTTCTTCCTGCACGACGTCTTCACGAACGTCGTC
TTCCCCGATCAGGATCTCGCGGCGCGCAGCGAGGCCGAGCTCCGGCGGCGCCGCTTGCAGCGGGTCCTGG
TGGCGGCGGCGGCGGCGCTCGTCGCCCTCCTGTTCCTGCTCCCGGCGCTGATCTCGTACTTCAACAACAA
GGCGCTCGTCGCCGAGACGAGGCGCATCTCGGACGAGATCGCGTTCGTGGACTGGTCCGGGCGGAGCGGC
GCCCCGCCGAACGTGCCCGCGAACATCGACAAGCTCGACCGGCTGCAGGGGCACGTGGGGAAGCTCGATC
AGTACGTCGAGAACACGCCCCTCGACCACGGCTGGTTCATGTTCCAGGGGGACAAGCTCTTCCCCCCGAC
GATGGGGCAGTACATCAAGAGCTTGAAGCAGGGGTTCGTCGGCCCGGCGAAGGCGCAGCTCGAGGCGAAG
CTCGAGCGGGTGCGCGACGGGGAGTTCCTGGACGGCTACAACGCCCTGCGCAGCTACCTCCTGCTCGGCA
AGGGCTATCAGGATCACATGGATGAGCAGGCGGCGCGGTGGCAGACCGGCCGGCTCGTCCAGGTCTGGGC
CGACATCCTGAAGCCGTTCACCGACATGCCCGAGAGCGACCTCAAGGAGCGGCTCACGCCGCACGTCGCC
TATTACATCGACCTCGTGCGGCGCAACAAGCTCGAGGCCGAGGAGCTGAACGATCCGCTCGTCGCGAGGG
CGCGGGCCGATCTCCTGCGGGTCGACCCGACGAAGCGCTACTACGACCAGTTCGTGACGAGCCTGATCGA
CCAGAAGTACGACGAGTCGGGGCCGAACACGCCGGAGAACCTGAAGTACCCGCCGGTGTCCCTGGACGAG
ATGTTCGCGGACCGGCCCGAGGTGCTGACCGTCATCCACAGCGCGCAGAAGAACCGGGGCGGGCCCTGGT
TCAAGGTGGAGGGGCCCTACACGGCCAAGGGGCACGCGCAGGTGCTCGAGTCGCTCAAGGAGGGGAGGAA
GAAGCTCGAGCGCGAGCTCTGGGTGCTCCCGCTGTCGAACGACGAGAAGCGGAGCGGCGACCAGATCCAG
AAGGAGCTCGACCGCGTCCGGCAGGACTACGACAACGCGTACATCGCGCAGTGGGAGGCGTTCTTCCGCG
ACATCCAGGTCGACATCCCGAAGACGAACCGCGACGCGATCCACGAGTTCCGGGTCCTCTCCACGCCCGA
CTGGCCCTACCGGCGGCTGCTCCAGCGGCTCCACGACGAGACGCAGTTCCCGGTGGAGAAGCCGAACGTG
CTCACCGCGGACGGCGGCATCATCGACAGGGCCAAGGACATGTTCGCGCAGCGGGTCGAGCGGCGGACGA
ACGTGCAGATCGGCTCGATGCTCCCGGGGCAGGGCGGGCGCGAGCACTACGACCCGGTGCCCGACAAGTT
CGAGTCGATGGCGGGCTTCGGGGTGCCGGCGGCGCCGGCGGAGGAAGGGCAGCCCCCGCCGCCTCCGCCC
AAGCTGGGCCAGTACGTCGGCCACCTCGAGCGGCTCGCCGGGGAGATGAGCGTCGTCGAGGACGGGCCGC
CGGACACGGACACCTCGAGGGCGACGGAGGCGTTCCAGGACGCGGTGAAAGAGACCCAGACGCTCCTGCT
CTCGATGGACCAGACCGGGCAGCGGCTGATGGAGCCGCTCCTCATGAACCCCCTCCGGCAGGCGTACAAG
GCGGTCGTGCGGCGCGCCGGCGGCGCGGCGAGCGGCATCTGGGAGGTCGAGGTCTGGCCGCACTACCGCG
ACAAGATCAAGGACCGGTACCCGTTCAACCTCGCCTCCTCCCGCGACGCCTCGCTCGAGGACGCGATGGC
CTTCTTCAAGCCGAAGGACGGCGTGCTCTGGGGCTTCTACGAGACGTACCTGAAGGGCTTCCACTACCAG
GTCGGGCACGAGTACTTCCCGAAATCGCACCTGTCGGGGCAGCCGCAGGCGGCGAAGCCGTTCACGCCGT
TCAACGCGAACCTGTACAACTGCCTGAGGCGCTCGGACGAGATCACCGACGCGCTCTTCGGGGGCGGCGG
CGCCGAGGGGCCCAAGGTCGTCTTCCACATCAACATGAAGACGGTCAGCCCCATCGTGAGCGAGGTGGTC
TTCGAGGTCGACGGCCAGAAGAGGCTCTATCGCAACGAGAAGGAGTTCTGGCACACCTTCAACTGGCCCG
GTGAGGGCGCGCCGGGCGCGAGGATCCAGGTGCGCGGCGCAGGCGGGCTCGACGAAGAGCTCGTGCGCGA
AGGGCCCTGGGGGATCTTCCGGCTGTTCGAGGCCGGGACCACGACCGCCCAGAAAGACAACGACGCGCTC
TTCACGGTGACCTGGCAGATGACCGCTCCGCCAGTGACCGTCACCATGGAGATCCGGCCGACCCGCGGGA
ACCATCCGTTCCCGATGAGCTTCTTCCGGGCGACCAACTGCCCGCCCAGCATCGGTGATCGCTTCGGCAA
AGGGTGA
 Primer design