SecReT6
Protein ID: 523522850
SecReT6 ID816
T6SS typei4b
Gene symbol-
Locus tagBJAB07104_01466
StrainAcinetobacter baumannii BJAB07104
Repliconchromosome [GenBank: NC_021726] [Browse all T6SS(s) in this replicon]
Location [Strand]1539994..1543818 [+]
Producthypothetical protein
NoteTssM
UniProt IDS5DC00
KEGG IDabj:BJAB07104_01466
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-72, Aligned region: 188..451
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 462..483
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 774..798
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 968..1080
Protein Sequence: 1274 a.a.     [Download]
>gi|523522850|ref|YP_008208929.1| hypothetical protein BJAB07104_01466 [Acinetobacter baumannii BJAB07104]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQRKKHAVQGEE
LAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
NGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFI
ATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRA
AVRFPALTVNQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRMLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMT
NLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQ
AFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFV
IRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSY
TVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGG
FEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|523521389|ref|NC_021726.1|:1539994-1543818 Acinetobacter baumannii BJAB07104, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGC
TTTAGGGCTCATCGCTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTTCAAGGTGAAGAG
CTTGCACAAGCGATTGAAAAGGATACCCAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAAC
TTATTAGCCAACAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAAAAGGGGAA
CGCAGCACTATATGAGTTGCCATGGTATATGGTCATTGGTAACCCAGCTGCTGGTAAAAGTTCTGCGATC
TATAATTCTGGTTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTA
CGCGTAATTGTGACTGGTTTTTTTCGACTGAGGGTATTTTACTCGACACCGCTGGACGTTATTCGGTCTA
TAGCGAAGACCACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCTAAGGCTCCAGTA
AATGGTTTAATTCTTATTGTTAGTATTGCTGAGCTTGTTAGTCAGAGTCCTGAACACTCATTAAAGCTTG
CGAAAAATTTACGCGCTCGTATTCAGGATTTAACCGAACGTTTAGAAGTGGTTGTACCCGTATATCTAGT
CTTTTCAAAAATGGATTTGATCGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGCACAAGAATATAAT
CAGGCGTGGGGCGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAAC
ACTACAATATTCTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAA
TATCTCACCTAGTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAACCTGCATTAAAAAGTTTTATT
GCGACATTGTTTGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACAAGTGCTT
TGCAAGAAGGCGTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGC
TCAAAGTGAAGTAAAAGATCAGCTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCA
GATGTCATTTTAAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATA
TTGCATTTATTGGTGCTTTAGCAGGCGTATCCATTATTCTCGGTGTGTGGGTTTGGTCATATCGTAATAA
TCAACAACTTATTGCCGAAGTTCAAGCTGATTTGAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAA
CAATTGTCGACTCAATTAGAGGCCTTACTTATCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATG
AAAATAGACCACTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGA
ATATTTAAAAGGTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGT
GTAAAAAATAACGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCTCAAACTC
AGCAATATTTAGAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGAT
GAGCAATCCACAGTATATGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTT
GATGCCAATAAAGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAA
TGACATTGGCAAATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCA
AGTATTGCTCTCTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATGAAATTAAAATGCGTGCT
GCTGTGCGCTTTCCAGCTTTAACTGTAAACCAGATTGTAGGTGACGCAAATAAAAATATTGTATTGGGTA
GTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAAGCAATTGAGGAAGC
AGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTCTCA
GGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAA
AATTCTTAAGTGGCATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATT
GGGCGAACCACAAAATTCACCAATTCGCATGCTTATTGAACGCGTAGCCATTGAAACAAACTGGGATAAT
CCGGTTGTTCAAGCAGAGTTAGCAGCGCCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAA
ACCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCA
AATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACG
AATCTTGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAATGCGATGA
CATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAA
GATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAA
GCCTTTGAAAGTTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAAC
CATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGA
AATTGGACAAATTCTTGGTGAGAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGACCCGTTTGTT
ATCCGCCGCGGTTATACCTTAACCTCCAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCACAATTTG
TTATGAACTTCCAACGCTATGTTGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCCAAGCACC
AGCTGCTCCGGCAACTAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAGTTACTTTCATAT
ACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTTATTTGGC
CAAATCAAGGCAGTATTCCGGGTGCTCGTATTACGGCTGTAGATTTACAAGGTCAAACACATACCATTTT
TGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAACGGTGGT
TTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTTATTAGTA
GTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAACTGCGGA
TAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAACTGAAAAT
CCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design