SecReT6
Protein ID: 523526702
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01409
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1490989..1491492 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5D8V9
KEGG IDabaj:BJAB0868_01409
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|523526702|ref|YP_008212733.1| hypothetical protein BJAB0868_01409 [Acinetobacter baumannii BJAB0868]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1490989-1491492 Acinetobacter baumannii BJAB0868, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCTCGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCAGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCCGAGG
CCGATCATGAATAA
 Primer design