SecReT6
Protein ID: 523526703
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01410
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1491485..1492966 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5D176
KEGG IDabaj:BJAB0868_01410
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|523526703|ref|YP_008212734.1| hypothetical protein BJAB0868_01410 [Acinetobacter baumannii BJAB0868]
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1491485-1492966 Acinetobacter baumannii BJAB0868, complete genome
ATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATCTTTTAGATTCGATTG
TTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTTAATTGGTGAGCTTGC
TAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGT
CAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCATTAAAATTCGTATGCT
TAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGATCAAAGCACTTTGTTT
AAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTG
AGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGCAGCGGCAGCACATGC
ACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCAC
GTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGAC
AGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTGTGGATGAATGCAGCT
TATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGCGGTGTTG
AAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGGCGAAGTGGTATTCAA
GTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGCTTCATTCCGTTA
GTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTAT
TGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCGTTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTACCTCAG
TCCTCAAATTAA
 Primer design