SecReT6
Protein ID: 523526704
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01411
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1493016..1493519 [+]
ProductHemolysin-coregulated protein (uncharacterized)
NoteTssD
UniProt IDS5CY92
KEGG IDabaj:BJAB0868_01411
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|523526704|ref|YP_008212735.1| Hemolysin-coregulated protein (uncharacterized) [Acinetobacter baumannii BJAB0868]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1493016-1493519 Acinetobacter baumannii BJAB0868, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA
 Primer design