SecReT6
Protein ID: 523526705
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01412
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1493599..1494075 [+]
Producthypothetical protein
NoteTssE
UniProt IDS5D2B8
KEGG IDabaj:BJAB0868_01412
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|523526705|ref|YP_008212736.1| hypothetical protein BJAB0868_01412 [Acinetobacter baumannii BJAB0868]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1493599-1494075 Acinetobacter baumannii BJAB0868, complete genome
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGTTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAG
TTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCA
TTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA
 Primer design