SecReT6
Protein ID: 523526706
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01413
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1494092..1495903 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5CXN1
KEGG IDabaj:BJAB0868_01413
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-156, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|523526706|ref|YP_008212737.1| hypothetical protein BJAB0868_01413 [Acinetobacter baumannii BJAB0868]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQEVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1494092-1495903 Acinetobacter baumannii BJAB0868, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGAGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGGCATTTTCCTGCGTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGAGTACAGTGTGAGTTTAATACAACTCAAGAGGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTTGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTGGATTTTTTAAGGCGACTACCTCAGCATGTATCCGAATTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCCGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCACAA
GCAATTAGAATATCCTTTAGTTACAGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCGATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACT
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA
 Primer design