SecReT6
Protein ID: 523526707
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01414
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1495867..1496865 [+]
Producthypothetical protein
NoteTssG
UniProt IDS5D8W1
KEGG IDabaj:BJAB0868_01414
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|523526707|ref|YP_008212738.1| hypothetical protein BJAB0868_01414 [Acinetobacter baumannii BJAB0868]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDETEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1495867-1496865 Acinetobacter baumannii BJAB0868, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTATCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAACTTTCCAGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAACGTGTTCATTTAACAAACCTGATCGTTGGTCTGACTGGTATACAAGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCA
TAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGTTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGCGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGACTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GTTTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATTGGAGAGCAAATATGA
 Primer design