SecReT6
Protein ID: 523526711
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01418
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1503129..1503896 [+]
ProductOuter membrane protein-related peptidoglycan-associated (lipo)protein
NoteTagL
UniProt IDS5CXN5
KEGG IDabaj:BJAB0868_01418
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 21..44
OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0046, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|523526711|ref|YP_008212742.1| Outer membrane protein-related peptidoglycan-associated (lipo)protein [Acinetobacter baumannii BJAB0868]
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQSLVQPPYQLFSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1503129-1503896 Acinetobacter baumannii BJAB0868, complete genome
ATGAATCAAAAATATCAAATTAAACTTTCACAACTTATAAAAGGCTGTTTTATATATGCAATTGCGAATT
ATGCTTTAGCACAGCCTATAGTTGTAGAAGGTGTAGTGCCAAATGAAGCAAGTAAACAGGCTATTTTAAT
GAAAATGCAGTCTGTTTATGGTGCAGATCAGGTTGTCGATAAAATACAAGTTCGACCAGTTGCCGCTCCA
AATGGATGGAGTGACTCTGTCACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTTAA
GTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATTCA
GTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGCAG
AAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGAAG
CTGGGCAAAAAATTCTTGATGAAATGGCTGTGGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATTGT
GGGGCATACCGATAGTTCTGGTGATGCGACCAAAAACTTAAAACTCAGCCAAGATCGAGCTTTAGCAGTT
AAAAATTATTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAAGC
CTGTAGCGGACAATACTTCTGCGGAAGGTAGGAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG
 Primer design