SecReT6
Protein ID: 523526712
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01419
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1503913..1504176 [+]
Producthypothetical protein
NotePAAR
UniProt IDS5D8W6
KEGG IDabaj:BJAB0868_01419
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|523526712|ref|YP_008212743.1| hypothetical protein BJAB0868_01419 [Acinetobacter baumannii BJAB0868]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1503913-1504176 Acinetobacter baumannii BJAB0868, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG
 Primer design