SecReT6
Protein ID: 523526713
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01420
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1504396..1507077 [+]
ProductATPases with chaperone activity, ATP-binding subunit
NoteTssH
UniProt IDS5D183
KEGG IDabaj:BJAB0868_01420
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 229..307
AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 606..774
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 230..343
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 611..729
AAA_5 [PF07728], Evalue: 6.00E-14, Aligned region: 230..252
AAA_5 [PF07728], Evalue: 6.00E-14, Aligned region: 610..731
ClpB_D2-small [PF10431], Evalue: 4.90E-13, Aligned region: 384..397
ClpB_D2-small [PF10431], Evalue: 4.90E-13, Aligned region: 780..850
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 10..73
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 207..252
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 474..516
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 605..654
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 676..704
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 229..323
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 454..503
AAA_22 [PF13401], Evalue: 5.80E-09, Aligned region: 607..637
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 227..248
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 607..717
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 230..250
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 606..632
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 230..302
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 606..637
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 833..865
AAA_14 [PF13173], Evalue: 4.70E-07, Aligned region: 230..333
AAA_14 [PF13173], Evalue: 4.70E-07, Aligned region: 608..693
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 230..277
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 609..647
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 224..290
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 610..630
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 230..328
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 610..649
AAA_18 [PF13238], Evalue: 8.20E-06, Aligned region: 230..260
AAA_18 [PF13238], Evalue: 8.20E-06, Aligned region: 488..542
AAA_18 [PF13238], Evalue: 8.20E-06, Aligned region: 611..640
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 63..104
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 209..243
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 282..379
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 472..489
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 606..656
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 605..650
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 229..248
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 574..632
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 679..705
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 222..246
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 605..634
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 714..734
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 231..254
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 611..632
T2SE [PF00437], Evalue: 0.001, Aligned region: 215..249
T2SE [PF00437], Evalue: 0.001, Aligned region: 423..458
T2SE [PF00437], Evalue: 0.001, Aligned region: 582..679
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 230..267
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 610..633
Atg14 [PF10186], Evalue: 0.0035, Aligned region: 438..520
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 225..250
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 589..633
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 231..302
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 609..631
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 230..253
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 278..310
TIP49 [PF06068], Evalue: 0.0042, Aligned region: 610..645
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 230..250
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 281..306
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 610..631
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 230..332
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 385..507
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 609..641
MobB [PF03205], Evalue: 0.0064, Aligned region: 231..264
MobB [PF03205], Evalue: 0.0064, Aligned region: 609..640
Clp_N [PF02861], Evalue: 0.0078, Aligned region: 32..74
Clp_N [PF02861], Evalue: 0.0078, Aligned region: 102..132
Protein Sequence: 893 a.a.     [Download]
>gi|523526713|ref|YP_008212744.1| ATPases with chaperone activity, ATP-binding subunit [Acinetobacter baumannii BJAB0868]
MMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADALADD
LKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLF
PIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAVTPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGR
EYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKG
EFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYF
EKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSV
LDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKSQLESLQSEIQETQEQ
WQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKM
VNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANE
LYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFY
QVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLG
RMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTV
LPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1504396-1507077 Acinetobacter baumannii BJAB0868, complete genome
ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTG
CTAATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCA
GCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTAGCAGATGAT
TTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAATCAATTGTTC
GTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACT
GGTTGCATTATTAACTGCACCTGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTCGATCTTTTC
CCGATAGACTCAATGAAACATAAGTTTCTCGAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAA
AAACATCTTCACAAGCAGATGAATTAGAACAAGCCGTGACTCCAACTGCAAAAACTCAAAAAACACCTGC
TTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCGT
GAATATGAAATTCGTTTGATGCTCGATATTTTAATGCGTAGACGTCAGAACAACCCAATTTTAACTGGTG
AGCCAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGA
GGCATTAAAAAATGTACATTTGCATGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGTGTTAAAGGT
GAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTATTTTATTTA
TTGATGAAGCACATACGCTTATTGGAGCTGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAA
ACCTGCACTTGCACGTGGCGAGTTACGTACTATTGCTGCAACGACATGGGCAGAATATAAACAGTATTTT
GAGAAAGATGCTGCATTGAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTG
TAGATATGTTACGTGCAATGATTCCTGTAATGCAAAAGCACTTTAATTTACAAATTGATGATGAAGCAAT
TGTAACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCAGTAAGTGTT
CTTGATACTGCGGCAGCGCGTGTAGCTTTGACCCAAAATGCACAGCCAGTCAAACTTGATCAATTAAAAG
CACAAGAACATAACTTAAAGCTTGAGCAACAGATTTTGGAAAATGAACACCGTCAGATTCCAATACATCA
TGAAAGATTAGAAAATCTGAAAAGCCAACTAGAGTCATTACAAAGTGAGATCCAAGAGACTCAGGAACAA
TGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCTAATGAGTCTG
AAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTT
TGAGCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACTGGTATTCCTGTTGGGAAAATG
GTCAATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATT
ATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAATAAACCTCA
AGGGGTGTTCCTTTTAGTTGGACCTAGTGGGGTTGGTAAAACCGAAACTGCTTTAGCCTTGGCTAATGAG
TTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTT
CGCTTAAAGGTGCTCCTCCAGGCTATGTGGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGTCG
TAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAGTTGTTCTAT
CAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAACACGACAATCT
TATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCC
TACCGCGGAAGATTTAATCGAACATTTAAAACCGAGTTTATATAAACAGTTTAAGCCAGCCTTCTTAGGG
CGTATGAGAGTTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGG
GCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATATTCAGATGACTTGGTCGAGTT
GCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTT
TTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGATCATGATTG
ATGCAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACGGACTAGTAA
AAAGTTGAAATCAGAAGTTTAA
 Primer design