SecReT6
Protein ID: 523526714
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01421
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1507101..1508195 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5CY99
KEGG IDabaj:BJAB0868_01421
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|523526714|ref|YP_008212745.1| hypothetical protein BJAB0868_01421 [Acinetobacter baumannii BJAB0868]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEK
TKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKK
VPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEW
NVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVS
DQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1507101-1508195 Acinetobacter baumannii BJAB0868, complete genome
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCAT
TTTCTAATGAATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAACGGAAGCAGGCAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAA
ACCAAAGATATCCGTCTATTAACTTGGGTAATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGG
TAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTGAAGA
TGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAAGAAA
GTACCTTTAACCAATACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATATCACGAAAATA
TACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGG
AATGTTTTAAAACAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTG
CATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCC
GAGCCAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAAGTGCTGC
AAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGCTATATGCTCCAAAAGACCAT
TAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATTGCAAATG
GTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA
 Primer design