SecReT6
Protein ID: 523526716
SecReT6 ID817
T6SS typei4b
Gene symbol-
Locus tagBJAB0868_01423
StrainAcinetobacter baumannii BJAB0868
Repliconchromosome [GenBank: NC_021729] [Browse all T6SS(s) in this replicon]
Location [Strand]1509594..1510400 [+]
Producthypothetical protein
NoteTssL
UniProt IDS5CXP0
KEGG IDabaj:BJAB0868_01423
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-52, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|523526716|ref|YP_008212747.1| hypothetical protein BJAB0868_01423 [Acinetobacter baumannii BJAB0868]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKDRLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|523525298|ref|NC_021729.1|:1509594-1510400 Acinetobacter baumannii BJAB0868, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAACAATAATA
GCCAGTCCCAAGTAAAATTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGTCCATTACAGTTAAGCCTGTTTGGTTCACAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGATCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGTTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTACTTACCTTGA
 Primer design