SecReT6
Protein ID: 523530608
SecReT6 ID818
T6SS typei4b
Gene symbol-
Locus tagBJAB0715_01487
StrainAcinetobacter baumannii BJAB0715
Repliconchromosome [GenBank: NC_021733] [Browse all T6SS(s) in this replicon]
Location [Strand]1562124..1565948 [+]
Producthypothetical protein
NoteTssM
UniProt IDS5CXQ5
KEGG IDabab:BJAB0715_01487
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-72, Aligned region: 188..451
IcmF-related [PF06761], Evalue: 9.60E-53, Aligned region: 462..483
IcmF-related [PF06761], Evalue: 9.60E-53, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 4.20E-25, Aligned region: 774..798
DUF1215 [PF06744], Evalue: 4.20E-25, Aligned region: 968..1080
Protein Sequence: 1274 a.a.     [Download]
>gi|523530608|ref|YP_008216635.1| hypothetical protein BJAB0715_01487 [Acinetobacter baumannii BJAB0715]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQRKKHAVQGEE
LAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
NGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFI
ATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRA
AVRFPALTVSQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMT
NLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQ
AFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFV
IRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSY
TVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGG
FEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|523529121|ref|NC_021733.1|:1562124-1565948 Acinetobacter baumannii BJAB0715, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGC
TTTAGGGCTCATCGCTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTTCAAGGTGAAGAG
CTTGCACAAGCGATTGAAAAGGATACCCAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAAC
TTATTAGCCAACAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAAAAGGGGAA
CGCAGCACTATATGAGTTGCCATGGTATATGGTCATTGGTAACCCAGCTGCTGGTAAAAGTTCTGCGATC
TATAATTCTGGTTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTA
CGCGTAATTGTGACTGGTTTTTTTCGACTGAGGGTATTTTACTCGACACCGCTGGACGTTATTCGGTCTA
TAGCGAAGACCACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCTAAGGCTCCAGTA
AATGGTTTAATTCTTATTGTTAGTATTGCTGAGCTTGTTAGTCAGAGTCCTGAACACTCATTAAAGCTTG
CGAAAAATTTACGCGCTCGTATTCAGGATTTAACCGAACGTTTAGAAGTGGTTGTACCCGTATATCTAGT
CTTTTCAAAAATGGATTTGATCGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGCACAAGAATATAAT
CAGGCGTGGGGCGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAAC
ACTACAATATTCTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAA
TATCTCACCTAGTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAACCTGCATTAAAAAGTTTTATT
GCGACATTGTTTGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACAAGTGCTT
TGCAAGAAGGCGTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGC
TCAAAGTGAAGTAAAAGATCAGCTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCA
GATGTCATTTTAAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATA
TTGCATTTATTGGTGCTTTAGCAGGCGTATCCATTATTCTCGGTGTGTGGGTTTGGTCATATCGTAATAA
TCAACAACTTATTGCCGAAGTTCAAGCTGATTTGAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAA
CAATTGTCGACTCAATTAGAGGCCTTACTTATCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATG
AAAATAGACCACTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGA
ATATTTAAAAGGTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGT
GTAAAAAATAACGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCTCAGACTC
AGCAATATTTAGAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGAT
GAGCAATCCACAGTATATGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTT
GATGCCAATAAAGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAA
TGACATTGGCAAATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCA
AGTATTGCTCTCTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATGAAATTAAAATGCGTGCT
GCTGTGCGCTTCCCAGCTTTAACTGTAAGCCAGATTGTAGGTGACGCAAATAAAAATATTGTATTGGGTA
GTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAGGCAATTGAGGAAGC
AGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTCTCT
GGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAA
AATTCTTAAGTGGTATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATT
GGGTGAACCACAAAATTCACCAATTCGCACACTTATTGAACGCGTAGCTATTGAAACAAATTGGGATAAT
CCGGTCGTTCAAGCCGAGTTAGCAGCACCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAA
ATCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCA
AATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACG
AATCTAGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAATGCGATGA
CATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAA
GATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAA
GCCTTTGAAAGCTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAAC
CATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGA
AATTGGACAAATTCTTGGTGAAAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGATCCGTTTGTT
ATCCGCCGTGGTTATACCTTAACCTCAAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCACAATTTG
TCATGAACTTCCAACGCTATGTCGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCCAAGCACC
AGCTGCTCCGGCAACCAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAGTTACTTTCATAT
ACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTTATTTGGC
CAAATCAAGGCAGTATTCCGGGTGCTCGTATTACGGCTGTAGATTTACAAGGTCAAACACATACCATTTT
TGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAACGGTGGT
TTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTTATTAGTA
GTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAACTGCGGA
TAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAACTGAAAAT
CCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design