SecReT6
Protein ID: 525711921
SecReT6 ID819
T6SS typei4b
Gene symbol-
Locus tagF504_4455
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1242849..1246778 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDM4V2S8
KEGG IDrse:F504_4455
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-73, Aligned region: 80..102
ImcF-related_N [PF14331], Evalue: 2.40E-73, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 9.70E-53, Aligned region: 488..860
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 996..1109
DUF4131 [PF13567], Evalue: 0.0063, Aligned region: 18..68
DUF4131 [PF13567], Evalue: 0.0063, Aligned region: 424..482
Protein Sequence: 1309 a.a.     [Download]
>gi|525711921|ref|YP_008238184.1| IcmF-related protein [Ralstonia solanacearum FQY_4]
MRRFLNFLTHSRTLSVLGVLALTIILLLIALTFEIGLVWAGIALGVLLALWLATALWKRWRARRASARLE
GVLEQAADKSAAPDKREEVEALRVRLAEAVKTIKRSKLGQLSGDAALYELPWYIVIGNPAAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ATLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQISLHQKNKLSPGLLSFPLEFASIKPALRAFLVTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKVIFSDR
QTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLAEVNTHPEQL
APMVRPPETGAVIATSVTSATATIAASGAAAGAPASPTATAAAPAGKRFTDASPSNVEDGYNALKTYLML
SDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQTRE
NLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGGNVIAGSYAVPGTFTKEAWQGYVQPAIREA
ASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVAVQDFTSFEQAVAGMNLL
GDPTNSPIRKVLDTAYDQTSWDNPSMLNAGLKQAKSGVLGWFKQLFARQTPSQINVNVDVGGNAETGSIP
MGPVGKEFAGLARVAVMHDDKSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSELADTL
KYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVIRPASVEINKVWNAQVYQPFSQTLAEKYPFAANAKI
EASATEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTAGFTRWIAPLTGGAAGG
AGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGTPGARVTATTFDGRTV
ELLNEPGRFGLERLIATANRKRRPDGAFDLTWARGDISVSVSLRIISSPQTAGTSGSDSPQGQGLRGLRL
PTSIADATASQNTATPPAPAGSRPASAAAATTQATARTLVTQEQGGTAQ
 
Nucleotide Sequence: 3930 bp     [Download]
>gi|525710956|ref|NC_021745.1|:1242849-1246778 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGCGACGCTTCCTCAACTTCCTGACCCACTCACGCACGCTCTCGGTTCTGGGCGTGCTCGCGCTGACGA
TCATCCTGCTGCTGATCGCGCTGACCTTCGAGATTGGCCTGGTCTGGGCCGGCATCGCGCTCGGCGTGCT
GCTGGCGCTGTGGCTGGCGACGGCGCTCTGGAAACGCTGGCGCGCGCGCCGGGCGAGCGCCAGGCTCGAA
GGCGTGCTGGAGCAGGCCGCCGACAAGAGCGCCGCGCCGGACAAGCGCGAGGAAGTCGAGGCGCTGCGCG
TGCGCCTGGCCGAGGCAGTCAAGACCATCAAGCGCTCCAAGCTCGGGCAGCTGTCGGGCGATGCGGCCCT
CTATGAGCTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCCGGCAAGAGCACGGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCG
CCGCGAATGGCTCGGCTTCCTCGACCTGCTCAAGCGCTACCGTCCCAAGGCGCCGATCAACGGCATCGTC
GTGACGGTGAGCGTGTCGGAGCTCACGCAGAACCGTCCCGAGTTCGCCATCAACCTCGCCAAGAACCTGC
GCCAGCGCGTGCAGGAGTTGACCGAGCGGCTGGAAGTGTTCGCCCCGGTCTACGTGATGTTCACCAAGGC
CGACCTGATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGCGACCGCGTATGGGGC
GCCACCCTGCCCTTCGAGCCGGACGCCAAGCCCGACGTGGCGGCGCTGTTCGACCAGCGCTTCGATGAGC
TGTGCGACGGGCTGAAGGAGATCAGCGTGGCGCAGATCTCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTTCCGCTGGAGTTCGCCTCGATCAAGCCGGCACTGCGCGCCTTCCTGGTGACGCTGTTC
GACGAGAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCCTCGGCCGAACGCATCGCGCGCCGCTTTGGGCTCAGCACGGACGGCGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTCATCTTCTCCGACCGC
CAGACCGTGCGGCAATTCGCCAGCCCGGCCAAGACGCGCCTGCGCATCGCCACCTTCTTCGGGCTGGTGC
TGGCGCTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCGTACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGACCTCGACAAGATCGTCAAGCTGCAGCAGAACCGCGTCGACCTGCAAGCCCGGCTGGAAGCG
CTGGACATCCTGCAGGACCGCATCGAGCAGCTCGAGCGCTTCCGCGGCGAGCATCCGCTGGCGCTGTCGC
TGGGGCTATACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAACGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCCGAGGTCAACACGCACCCCGAGCAGCTC
GCGCCGATGGTGCGCCCGCCCGAGACCGGCGCGGTGATCGCCACCTCCGTCACCTCGGCGACGGCCACCA
TCGCGGCTTCGGGCGCCGCCGCCGGTGCGCCGGCATCGCCCACGGCCACGGCCGCCGCGCCGGCCGGCAA
GCGCTTCACCGATGCCTCGCCCTCCAACGTGGAAGACGGCTACAACGCGCTCAAGACCTACCTGATGCTG
TCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGG
AAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCTGTCGTTCTTCCT
CGCCCGCGTGAATGACGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGACCAGACCCGCGAG
AACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAACGCGCCTACGCCGAGATCAAGGCCCGCGCCT
CGACCCGCTATGCGCCGATGACGGTCGCGCGCATCGTCGGCGAGACCGGCGGCAACGTGATCGCCGGCAG
CTACGCCGTGCCCGGCACCTTCACCAAGGAGGCATGGCAGGGCTACGTGCAGCCCGCCATCCGCGAGGCC
GCCAGCAAGGAGCTGCAGACCAAGGACTGGGTGCTCAACGTGGCCGCCCGCGACGACCTGACGCTCGAAG
GCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCGCGAGTGGCAACG
CTTCATGCAGGGCGTGGCCGTGCAGGACTTCACCAGCTTCGAGCAGGCCGTGGCCGGCATGAACCTGCTG
GGCGATCCGACCAACTCACCGATCCGCAAAGTGCTCGACACCGCCTACGACCAGACCTCGTGGGACAACC
CGTCCATGCTCAACGCCGGCCTCAAGCAGGCCAAGTCGGGCGTGCTGGGCTGGTTCAAGCAGCTCTTCGC
GCGGCAGACACCGTCGCAGATCAACGTCAACGTGGACGTGGGCGGCAACGCCGAGACCGGCAGCATCCCG
ATGGGGCCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGCGGTGATGCACGACGACAAATCGCTGC
TGCGCGGCTACATGGACGCGCTGTCCAAGGTCCGCACCCGCTTCAACCTCATCAAGAACCAGGGCGACCC
CGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTGGCCGACACCCTC
AAGTACGTCGATGAGCAGATGCTGACCGGCATGACCGACAGCGAACGCCAGACGCTGCGCCCGCTGCTGG
TGCGCCCGCTGCTGCAGTCATATGCGGTGGTGATCCGGCCGGCCAGCGTGGAGATCAACAAGGTGTGGAA
CGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGGCCGAGAAGTATCCGTTTGCCGCCAACGCCAAGATC
GAGGCCAGCGCGACCGAGATCGGCCAGATCTTCGGGCCGGAGGGCGCCATCGCCAAGTTCGCCAACACGA
CCATTGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCGGCCCGCACCTGGGGTGACCTGGGCCTGGC
CTTCGTGCCCGAGTTCACCGCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGTGCGGCGGGCGGT
GCCGGTGGCGCGGCGGCCGCGGCGCCGCAGACGGTGTTCCAGATTCTGCCGGTGCCGTCGCAGGGCACCA
CCGAATACACCATCGAGATCGACGGCCAGCAGCTGCGCTACCGCAACACGCCGCCGCAATGGGCCAACTT
CGTCTGGCCGAATCCGCAGGGCACGCCGGGCGCGCGCGTGACGGCCACGACCTTCGACGGCCGCACCGTG
GAGCTGCTCAACGAACCGGGCCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACCGCAAGCGTCGCC
CCGATGGCGCGTTCGACCTGACGTGGGCGCGCGGCGACATCAGCGTGTCGGTCAGCCTGCGCATCATCAG
CAGCCCGCAGACGGCCGGCACCTCGGGCTCCGACTCGCCGCAAGGCCAGGGCCTGCGCGGCCTGCGCCTG
CCGACCTCGATCGCGGACGCGACCGCCTCGCAGAACACCGCCACGCCGCCCGCGCCGGCAGGCAGCCGCC
CGGCCAGCGCGGCCGCCGCGACGACCCAGGCCACCGCCCGGACCCTCGTCACGCAAGAGCAAGGGGGGAC
GGCGCAATGA
 Primer design