SecReT6
Protein ID: 525848298
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23115
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1511341..1514859 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDS5ITZ8
KEGG IDvpf:M634_23115
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-86, Aligned region: 502..805
ImcF-related_N [PF14331], Evalue: 3.70E-86, Aligned region: 190..451
DUF1215 [PF06744], Evalue: 1.50E-38, Aligned region: 919..1034
AAA_16 [PF13191], Evalue: 0.0057, Aligned region: 40..115
AAA_16 [PF13191], Evalue: 0.0057, Aligned region: 125..192
AAA_19 [PF13245], Evalue: 0.006, Aligned region: 127..142
Protein Sequence: 1172 a.a.     [Download]
>gi|525848298|ref|YP_008268937.1| type VI secretion protein IcmF [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MSIKEIGRVFTQRWFLGLVGVAACSIFIWVVGPLITVAGYEPLKSDFQRLVTILVIVFAWALINLTKQRK
QKVREDESIQTLLEVDSQSDKEAASEIDVMRDRIEQAIKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLTESLGADSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTVSLASVMSQTRTERSLHARSIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFADLS
KEEREELFGFMFPREVDDERGVISLFNKEFHGMLERLDARMLRILETEDDLEKRTLIFEFPKQLRVLQAN
LDEFLSEIFAQNTFEEPALIRGVFLLSSVQEGIPVDRLMSESTNGLGLGRLPLATNVNSSHSYFVKNLFE
RVIFKEQLLGTVNRHYQKQSGWMRTGIYVGCAGVLVGASALWFLSYQWNSKLIVDTNNQANHIEAMIGAE
SLDFESDVISAVDTLDKIMMLPLGKNSEYGHSDAVKKFGLYQGDKVSQAANNAYSDALSQHFATLLSESL
LSEMEANKQHREYLYETLKTYLMLFNPEKYQQEEVITWFNFYFERQYPGELNKELRERLLVHTKNLLEND
EKGFSMNATAISAAREVLTQMSLPERAYQRMKMQFAKSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKGLMEENWVYGDDLKAHEIDHDSAIQGVQARYYQDYVNEWKTLIEDVQLK
QAPSLALATEQSRVLSGVERPIESLLRAIQKEVGLSKVTLSENQKAATEVAGKVAKVKFSNKADKLDMYL
PEENGFNVALPGKEVESHFTEILRLSEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKDLLPKPFNQWLGELSQESVKFAESGSKDHLNQLWVTNVVRPYQRTIAGRYPFEPNATKEVRL
KDFQRFFGYGGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLAVFQRAKRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGDQDLVYKHGPARSKELRWPSGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRNDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPQTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1514859-1511341 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAGTATTAAAGAAATAGGCAGAGTATTTACCCAAAGATGGTTTCTTGGTTTAGTCGGTGTAGCCGCGT
GCTCCATTTTTATTTGGGTTGTGGGTCCTCTGATCACGGTTGCAGGTTACGAGCCGCTTAAAAGTGATTT
TCAACGTTTAGTTACGATCTTAGTGATTGTTTTTGCTTGGGCGCTTATCAACTTAACAAAGCAGCGCAAA
CAGAAAGTTAGAGAAGACGAAAGTATTCAGACGTTGCTTGAAGTAGACAGCCAATCAGACAAAGAAGCCG
CCAGTGAAATTGACGTAATGCGCGATCGTATAGAGCAAGCGATCAAAGTTGTGACAAAAACGCATAAAGG
AAAGCGTAGTTTGTACGATTTACCTTGGTACGTTCTGATTGGTCCTCCTGGAACAGGTAAAACCACGGTT
CTAAAGCAATCTGGCTTGGAATTTCCGTTAACTGAGAGCTTAGGAGCTGACTCTATAGCTGGTGTAGGTG
GAACACGTCACTGTGATTGGTGGTTTGCTAATAAAGCAGTACTTATTGATACAGCAGGACGTTACACCAC
GCAAGATAGTCAAGAAAAGGTTGACTCTAAAGCTTGGCACGGTTTCTTAGGGTTGCTTAAGAAATACCGC
ACTCAAAGGCCTATCAATGGCGCTATCGTAACAGTCAGCCTAGCAAGTGTGATGTCTCAAACTCGTACGG
AGCGTAGCTTACATGCCAGATCAATAAAATCTCGCCTTCAGGAACTCAAAAATCAGTTGGGTATGCAATT
CCCAATCTATGTTCTGCTGACGAAAATGGATCTGGTTGCTGGCTTTAATGAATTTTTTGCTGATTTAAGT
AAAGAAGAGCGTGAGGAACTTTTTGGATTTATGTTCCCACGAGAAGTTGATGACGAACGTGGTGTTATTT
CTCTATTCAATAAAGAGTTTCACGGCATGTTGGAGCGGCTCGATGCGCGCATGTTACGTATATTAGAAAC
TGAAGATGACTTAGAAAAGCGCACGCTAATATTCGAATTTCCAAAACAGCTGCGAGTTTTACAAGCAAAC
TTAGATGAGTTTTTGTCTGAGATATTTGCGCAGAACACGTTTGAAGAGCCAGCCCTTATTCGCGGTGTTT
TCTTGCTTAGCTCTGTACAAGAAGGCATTCCTGTTGATCGACTGATGAGTGAATCAACTAATGGATTGGG
ACTAGGGAGGTTGCCTTTAGCGACAAACGTTAACAGTTCGCATAGCTATTTTGTTAAAAATCTTTTTGAG
CGAGTCATCTTTAAAGAGCAATTACTAGGTACCGTTAACCGCCACTATCAAAAGCAATCTGGATGGATGC
GTACGGGCATATACGTGGGTTGTGCTGGTGTTCTTGTTGGTGCTTCTGCCCTTTGGTTCCTGAGTTATCA
ATGGAATTCAAAGTTAATTGTCGATACCAATAACCAAGCAAATCATATTGAAGCGATGATAGGTGCAGAG
AGCCTTGATTTTGAATCGGACGTTATCAGTGCTGTAGACACGTTAGACAAGATCATGATGTTGCCACTAG
GGAAAAATAGTGAATATGGTCATTCTGATGCAGTGAAAAAGTTTGGTCTGTATCAAGGTGACAAAGTTTC
TCAAGCAGCAAATAACGCGTATTCAGATGCTCTTTCTCAACACTTTGCTACTCTGCTGTCAGAGAGTTTG
CTCTCGGAAATGGAAGCGAATAAGCAGCATCGTGAATACTTATACGAGACGTTAAAGACGTATTTAATGT
TGTTTAATCCGGAAAAGTATCAACAAGAAGAGGTAATTACTTGGTTCAACTTCTACTTTGAACGTCAGTA
TCCAGGAGAGTTAAACAAAGAGCTACGTGAGCGTTTGCTAGTGCATACTAAAAACTTACTAGAGAACGAC
GAGAAAGGCTTCTCAATGAATGCGACTGCTATTAGTGCAGCACGAGAAGTTCTAACGCAAATGTCACTTC
CAGAGCGTGCATATCAGCGTATGAAGATGCAGTTTGCTAAAAGTCACGTTCCGTCTTTCCGTTTAACAGA
CGTGTTAGGACCTAAAGGTTTAGAACAATTTGAGCGAGCAAGTGGAAAACCTCTATCGCAAGGTATTTCC
GGTTTTTATACCTACAACGGTTTTCACAGCATTTTCCAAATTCAGATTAATCGCACCGTCAAAGGATTGA
TGGAAGAAAACTGGGTGTATGGGGATGATCTTAAAGCTCATGAAATTGATCATGATAGTGCTATTCAGGG
GGTTCAAGCCCGCTATTATCAAGATTATGTCAATGAGTGGAAAACTCTGATAGAGGATGTTCAGCTTAAA
CAAGCTCCGAGTTTGGCTTTAGCAACAGAGCAATCAAGAGTTTTATCCGGTGTAGAAAGACCAATTGAAT
CACTTCTGCGTGCAATACAAAAGGAAGTGGGGTTATCGAAAGTAACGTTATCGGAAAATCAAAAGGCAGC
AACGGAAGTCGCAGGAAAGGTTGCAAAAGTGAAGTTTTCTAATAAGGCAGACAAACTCGATATGTATTTG
CCTGAAGAGAATGGATTTAATGTTGCTCTACCAGGTAAAGAAGTTGAATCCCATTTCACCGAAATCTTAC
GACTTAGTGAACAAGACTTTGATGATATTCAGCAAGCGATGGTGAATTTGCGTTCGTACTTATCTGATTT
GTCTAGCTCAGGGAACAATCAAAAAATTGCTTACAAAAGCATATTGGATGGAACGGTAACTCAGGATGTT
GCTGCCTCCTTTGCTAGAGCAAAAGATCTCTTACCAAAACCGTTTAATCAATGGTTGGGAGAGTTGTCAC
AGGAATCGGTTAAGTTTGCAGAAAGCGGCTCTAAAGATCATCTAAATCAACTTTGGGTGACTAATGTAGT
GCGTCCTTATCAGCGGACTATAGCAGGTAGATACCCATTTGAACCTAATGCAACGAAGGAAGTTCGTCTA
AAGGACTTTCAACGATTCTTCGGGTACGGTGGTACGTTGGACTCGTTCTTCCAAGAATATCTGGAGCCGT
TTGTTGACACGTCTAAGAGTCGTTGGAGACTAGAAAAAGAAATCGGTGTAAGGCCCGAGACGCTTGCGGT
TTTTCAAAGGGCAAAACGCATTAGACAATCGTTCTTTGAATCAGATAACTCGCTACGAGTCGAGTTTGGT
ATGAAACCCGTATATCTAGATCAACACATTACTCGATTTGTGCTAGAGCTAGGTGATCAAGACTTGGTTT
ATAAGCACGGTCCTGCGAGATCGAAGGAACTTCGCTGGCCATCGGGTCAAGATCAGACGCGTATTGTGTT
TACACCGCCCGAATCAAAACGAGAAATTGCTCATACCTATGAAGGGGAATGGGGCATTTTCAAACTATTG
GACCAATCACTCAAGGCTCGACCAGAGTCCCGCAACGACAACATTGTCATGATTGATTTGAAGGGGAACA
AGGTTCAGCTTGAGTTGATTCCATCTAGTGCAATCAACCCATTTTGGTCTAATGAGATGGAGAGGTTCAG
ATGTCCGCAAACCTTGTAA
 Primer design